voice-chat-text-1

[ancient whale]

https://github.com/srg320

[stuck bluff]

collections.Counter```

[stuck bluff]

!e py import string print(string.ascii_letters)

[coarse hearth]

@stuck bluff :white_check_mark: Your eval job has completed with return code 0.

abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ

[misty sinew]

il be right back

[grave reef]

 File "<pyshell#1>", line 1, in <module>
    Sequence.count(self, 'MHSSIVLATVLFVAIASASKTRELCMKSLEHAKVGTSKEAKQDGIDLYKHMFEHYPAMKKYFKHRENYTPADVQKDPFFIKQGQNILLACHVLCATYDDRETFDAYVGELMARHERDHVKVPNDVWNHFWEHFIEFLGSKTTLDEPTKHAWQEIGKEFSHEISHHGRHSVRDHCMNSLEYIAIGDKEHQKQNGIDLYKHMFEHYPHMRKAFKGRENFTKEDVQKDAFFVNKDTRFCWPFVCCDSSYDDEPTFDYFVDALMDRHIKDDIHLPQEQWHEFWKLFAEYLNEKSHQHLTEAEKHAWSTIGEDFAHEADKHAKAEKDHHEGEHKEEHH')
NameError: name 'self' is not defined```

[stuck bluff]

!e py import collections print(collections.Counter('Apple and rhubarb.'))

[coarse hearth]

@stuck bluff :white_check_mark: Your eval job has completed with return code 0.

Counter({'p': 2, ' ': 2, 'a': 2, 'r': 2, 'b': 2, 'A': 1, 'l': 1, 'e': 1, 'n': 1, 'd': 1, 'h': 1, 'u': 1, '.': 1})

[stuck bluff]

@grave reef

[grave reef]

@stuck bluff

[stuck bluff]

!paste

[coarse hearth]

Pasting large amounts of code

If your code is too long to fit in a codeblock in discord, you can paste your code here:
https://paste.pydis.com/

After pasting your code, save it by clicking the floppy disk icon in the top right, or by typing ctrl + S. After doing that, the URL should change. Copy the URL and post it here so others can see it.

[grave reef]

https://paste.pythondiscord.com/jojomohina.py

[south onyx]

Hello! Recently just got into Game Development, C# and Python, and figured this would be the best place for advice! Call me Red, Ben, I don't mind!

[craggy heart]

I got into that DevOps project I was talking about.

They said I will mostly be working with GCE and Kubernetes

[stuck bluff]

@grave reef

!e py from collections import Counter from string import ascii_uppercase dictionary = {key:0 for key in ascii_uppercase} dictionary.update(Counter('Applesandoranges'.upper())) #dict.update operates on the lefthand dict in-place. print(dictionary) 

[coarse hearth]

@stuck bluff :white_check_mark: Your eval job has completed with return code 0.

{'A': 3, 'B': 0, 'C': 0, 'D': 1, 'E': 2, 'F': 0, 'G': 1, 'H': 0, 'I': 0, 'J': 0, 'K': 0, 'L': 1, 'M': 0, 'N': 2, 'O': 1, 'P': 2, 'Q': 0, 'R': 1, 'S': 2, 'T': 0, 'U': 0, 'V': 0, 'W': 0, 'X': 0, 'Y': 0, 'Z': 0}

[lofty hound]

whats good

[quaint nova]

my laptop boooom

while True:
  print("101001001")

😂

rip my laptop

[stuck bluff]

!e py class MyClass: def __init__(self): self.v = 5 print(len(dir(MyClass))) print(len(dir(MyClass()))) 

[coarse hearth]

@stuck bluff :white_check_mark: Your eval job has completed with return code 0.

001 | 26
002 | 27

[stuck bluff]

!e

from collections import Counter
a = Counter('ABABABAHGAL')
print(a)
print(dict(a))```

[coarse hearth]

@stuck bluff :white_check_mark: Your eval job has completed with return code 0.

001 | Counter({'A': 5, 'B': 3, 'H': 1, 'G': 1, 'L': 1})
002 | {'A': 5, 'B': 3, 'H': 1, 'G': 1, 'L': 1}

[stuck bluff]

from string import ascii_uppercase as alphabet```

!zen

[coarse hearth]

The Zen of Python, by Tim Peters

Beautiful is better than ugly.
Explicit is better than implicit.
Simple is better than complex.
Complex is better than complicated.
Flat is better than nested.
Sparse is better than dense.
Readability counts.
Special cases aren't special enough to break the rules.
Although practicality beats purity.
Errors should never pass silently.
Unless explicitly silenced.
In the face of ambiguity, refuse the temptation to guess.
There should be one-- and preferably only one --obvious way to do it.
Although that way may not be obvious at first unless you're Dutch.
Now is better than never.
Although never is often better than right now.
If the implementation is hard to explain, it's a bad idea.
If the implementation is easy to explain, it may be a good idea.
Namespaces are one honking great idea -- let's do more of those!

[stuck bluff]

!e py class MyClass: def __len__(self): return 7 my_instance = MyClass() print(len(my_instance)) print(my_instance.__len__())

[coarse hearth]

@stuck bluff :white_check_mark: Your eval job has completed with return code 0.

001 | 7
002 | 7

[stuck bluff]

!e py print(len('abc')) print('abc'.__len__())

[coarse hearth]

@stuck bluff :white_check_mark: Your eval job has completed with return code 0.

001 | 3
002 | 3

[grave reef]

'AAGGCCTT'

'TTCCGGAA'

'AGTCAATGC'

'TCAGTTACG'

[narrow sleet]

what u guys discussing??

[stuck bluff]

!e py trans = str.maketrans('ACGT', 'TGCA') print('GATTAGA'.translate(trans))

[coarse hearth]

@stuck bluff :white_check_mark: Your eval job has completed with return code 0.

CTAATCT

[grave reef]

 newSequence = ''
        for symbol in sequence[::-1]:
            newSequence += symbol
            if symbol == 
        ```

[stuck bluff]

!e py compliment = {'A': 'T', 'C': 'G', 'G': 'C', 'T': 'A'} print(compliment['A'] == 'T')

[coarse hearth]

@stuck bluff :white_check_mark: Your eval job has completed with return code 0.

True

[stoic bluff]

morning

[misty sinew]

!e

[coarse hearth]

Command Help

!eval [code]
Can also use: e

*Run Python code and get the results.

This command supports multiple lines of code, including code wrapped inside a formatted code
block. Code can be re-evaluated by editing the original message within 10 seconds and
clicking the reaction that subsequently appears.

We've done our best to make this sandboxed, but do let us know if you manage to find an
issue with it!*

[misty sinew]

so i did this weird symbol:
</>

wait wait-

i struggle 5099900 times.

like this

AH HECK

yea

¯_(ツ)_/¯

i start getting weird

ah

yea too much paragraphs.

[novel parcel]

¯_(ツ)_/¯

[misty sinew]

@raw wren search their name with "bot discord"

[raw wren]

I will

thx!

[hearty heath]

Hey

Yeah, try with my nickname 😄

[warm tendon]

😔

[hearty heath]

How about now? 😄

Oh yeah 😄

Check out my office set up today:

Getting some vitamin D 😄

[warm tendon]

bruh you're outside

tf?

the sun is out there

the glare D:

[hearty heath]

Ah, is that what that is?

[tiny pumice]

'ello

[hearty heath]

It's strange getting used to this 'sun' thing ngl.

[warm tendon]

it's a scam tbh 😔

[hearty heath]

It probably is used in some traditional medicines 😄

[hearty heath]

It's not too bad when you use light mode.

Am I even a programmer?

This is true

[warm tendon]

gruvbox 👎

solarized is ok actually

[hearty heath]

Yep, slightly paranoid 👀

This comes from listening to Rabbit 😄

[warm tendon]

👀

[hearty heath]

I switched to 'onehalf'

[warm tendon]

oh?

[hearty heath]

https://github.com/sonph/onehalf

[hearty heath]

Oh yeah. I think the company is Evergreen, and the Ever Given is one of its ships?

[warm tendon]

hey...actually? this looks pretty good lol

the dark theme is very nice and cute

[hearty heath]

Yeah, it's definitely pleasing.

[warm tendon]

but you use the light one 😔

[hearty heath]

Well, right now I am...

I've always kind of wanted to use a fax machine, but have never had a reason to. They seem kind of fun tbh

[warm tendon]

wack

[hearty heath]

Did you see the people vs OJ tv show?

I'm thinking of that scene where the lawyer faxes a hand-written note to the court room 😄

Erm, it was a dramatisation a couple of years ago. On Netflix.

Ah right 😄

[warm tendon]

they couldn't even put a glove on a 2d piece of paper

[peak frigate]

[hearty heath]

Fax machines are surprisingly old

[mild flume]

https://www.thoughtco.com/history-of-the-fax-machine-1991379

[raw wren]

Hey mina

[tawdry charm]

https://tenor.com/view/supernatural-jensen-ackles-dean-winchester-dean-spn-gif-5676497

what is a fax machine

[mild flume]

A method of sending documents over a phone line

[tawdry charm]

https://tenor.com/view/batman-i-see-think-thinking-pondering-gif-4994872

[hearty heath]

Apparently Japanese companies are like the largest market for fax machines today

Because they all insist on using paper.

Film 😄

Have you seen inglorious bastards?

[tawdry charm]

i think i have heard of it

[peak frigate]

thermal receipts!

[tawdry charm]

never watched it though

[hearty heath]

brb

[tawdry charm]

https://tenor.com/view/django-django-unchained-gif-18556564

[warm tendon]

but what about the chemistry behind it 😭

AgBr go Brrrrrrr

[tawdry charm]

https://tenor.com/view/hmmm-mmmm-interesting-batman-gif-11990772

https://tenor.com/view/radio-silence-hush-shh-be-quiet-bricky-gif-17190928

lol

[stuck bluff]

If an incense censor's sensor data is censored why is my foot covered in mayonaise?

[tawdry charm]

https://tenor.com/view/umm-confused-blinking-okay-white-guy-blinking-gif-7513882

...

https://tenor.com/view/obama-wtf-why-president-wut-gif-12221156

[hearty heath]

Is anyone else having connection issues?

[tawdry charm]

no

[hearty heath]

Or do I need to move closer to my router?

[tawdry charm]

get a ethernet cable

[hearty heath]

I'm outside 👀

[tiny pumice]

So we hanging out in vc-1 now lol

[tawdry charm]

well get closer to the router then

or change its antennas

[mild flume]

It's where everyone was when I got here

[narrow sleet]

hi guys

[tawdry charm]

hello

good sir

lol

[stoic bluff]

https://tenor.com/view/hello-there-private-from-penguins-of-madagascar-hi-wave-hey-there-gif-16043627

[narrow sleet]

whats the topic??

[tawdry charm]

https://tenor.com/view/django-leonardo-dicaprio-yes-nodding-yeah-gif-15456685

[stoic bluff]

we don't have a topic right now

[golden marsh]

note the miliseconds

[tawdry charm]

yeah its kind of all over the place

[narrow sleet]

that is the most productive discussions 😂

[tawdry charm]

https://tenor.com/view/so-it-would-seem-gif-18723492

ahahah

[stoic bluff]

@tawdry charm what are you doing rn?

[tawdry charm]

this

lol

[stoic bluff]

posting gifs?

[tawdry charm]

i guess

lol

[peak frigate]

we could do with less gifs here please & thank you :)

[stoic bluff]

delete it MED

[tawdry charm]

there

[stoic bluff]

thank you

[lavish plume]

ty

[peak frigate]

hahaha hi groovy

[raw wren]

where is your bot tag did you take it off today?

[narrow sleet]

nice name how did u think of it??

[dull dew]

bot

nvm

[stoic bluff]

why you here btw?

[mild flume]

Because people want to join the server?

Odd question to ask

[narrow sleet]

lol

[stoic bluff]

it was meant to be a joke cause robot

[mild flume]

Riiiiight

Got it

[raw wren]

beep boop

[narrow sleet]

bc??

[mild flume]

I'm derping badly today

[narrow sleet]

oh so bc= because??

[mild flume]

Yep

[golden marsh]

https://docs.microsoft.com/en-us/windows/win32/direct3dhlsl/dx-graphics-hlsl

[native vapor]

if 'bc' == 'because':
print("Yep")

[mild flume]

https://godvillegame.com/superhero

[rapid ocean]

osu's better change my mind

exactly

one doesn't take arm strength

ive got strong ass fingers now tho

sdsdsdsds

see that was super fast

ya

I started with qe cause leaning in fps's but ive got a super small desk and its hard to use anything else

[misty sinew]

a

[rapid ocean]

what about millennium?

[native vapor]

You know, it's great developing for a business unit outside the development shop...

[rapid ocean]

yes.

[native vapor]

I feel like a coding cowboy

Nobody tells me what to do nor understands it...so nice

[rapid ocean]

Đ for decades?

lots of comments get bulky too

[hearty heath]

Also, vimtutor

[haughty urchin]

my heroku app does not recognize my local timezone, it shows local timezone as UTC, how to configure my heroku app to recognize user's timezone??

[stoic bluff]

who sent that?

[haughty urchin]

i am using pytz library of python

[hearty heath]

Yeah, I also wouldn't like if if the community was too split into staff and non-staff.

[warm tendon]

that'd defeat the purpose of censoring huh

[stoic bluff]

okey jeez....

[simple musk]

@golden marsh I will reeeeeeeee

[mild flume]

if cog := self.bot.get_cog("ThisCog"):
   # Do stuff with it

[simple musk]

@wintry sinew 👋

[wintry sinew]

h

[simple musk]

h

[warm tendon]

while chunk := f.read(8):
  ...

[simple musk]

I tend to read docs on a case-by-case usage scenario

[wintry sinew]

https://en.wikipedia.org/wiki/Compilers:_Principles,_Techniques,_and_Tools

[long gust]

one last thing @mild flume , for each loop that the walrus operator runs, will it be reset to the initial value or can it be altered in the loop and keep its new value

[mild flume]

It resets at the top of the loop. So it re-evaluates it each time

[warm tendon]

!e

I = iter([1, 5, 2, 6, 7])
while element := next(I):
  print(element)

[coarse hearth]

@warm tendon :x: Your eval job has completed with return code 1.

001 | 1
002 | 5
003 | 2
004 | 6
005 | 7
006 | Traceback (most recent call last):
007 |   File "<string>", line 2, in <module>
008 | StopIteration

[simple musk]

e

[wintry sinew]

lmao i was gonna do that but you beat me to it

[simple musk]

tbh crisp worked terribly for me, but then again it was also unnecessary

laundmo what did you do

different langs have different uses

[wintry sinew]

are you telling me i shouldnt make an operating system in js??!!

[golden marsh]

?

[simple musk]

what vco said

[simple musk]

make an OS in lua

[wintry sinew]

computercraft

[simple musk]

okay fair

though in my defense

cp lua > lua > gmod lua

gmod lua is just...

[wintry sinew]

pretty sure there's a plugin for computercraft that lets you run micropython

[simple musk]

aye, I think sals modded server had it but I could be wrong

[hearty heath]

That's a good point @golden marsh

[tiny pumice]

Did some setup for viewing Markdown documents on my Emacs

Pretty clean

[wintry sinew]

tar -zxvf thing.tar.gz

[short isle]

Has everyone here heard about liveshare https://docs.microsoft.com/en-us/visualstudio/liveshare/

[golden marsh]

@misty sinew please reduce the amount of rubbing/rustling noise coming from your mic

[misty sinew]

Ok, fine

[hearty heath]

@misty sinew can you stop joining and leaving?

[golden marsh]

!voice @misty sinew

[coarse hearth]

Voice verification

Can’t talk in voice chat? Check out #voice-verification to get access. The criteria for verifying are specified there.

[hearty heath]

If you're wondering why you're muted

[misty sinew]

@misty sinew please send 50 non-deleted messages to verify.

who wants play rocket

league

[misty sinew]

?

[tiny pumice]

I'll be right back

[misty sinew]

what's mean send 50 non-deleted messages

[raw wren]

just look in here for how to verify @misty sinew

!verify

[misty sinew]

!verify

[raw wren]

!voice verify

[coarse hearth]

Voice verification

Can’t talk in voice chat? Check out #voice-verification to get access. The criteria for verifying are specified there.

[misty sinew]

can i spamm 50 messages for complete the quest

:D.

[coarse hearth]

:x: According to my records, this user already has a mute infraction. See infraction #30750.

:incoming_envelope: :ok_hand: applied mute to @misty sinew until 2021-03-30 15:09 (9 minutes and 59 seconds) (reason: burst rule: sent 9 messages in 10s).

[mild flume]

@misty sinew No, you can't actually

[misty sinew]

Don’t.

[mild flume]

In fact spamming will have me extend the amount of time it'll take for you to get verified by 2 weeks

From now

So I'm going to unmute you, but behave yourself

!unmute @misty sinew

[coarse hearth]

:incoming_envelope: :ok_hand: pardoned infraction mute for @misty sinew.

[misty sinew]

❤️

[misty sinew]

:/

(1) the pen is on the table

[golden marsh]

@misty sinew if you ever wanna do comamndline programs in python: https://pypi.org/project/blessed/

[misty sinew]

(2) i'm trying to speak on the channel

i'm not spamming

(3) it's so hard complete this quest

(4) i'm sure i'm not spamming

(5) i've completed 1/10 of the quest

(6) I-CAN-DO IT

(7) I'M DOING IT

(8) this is the 8th message i've sent

[mild flume]

!tvban 481965351559757844 2w We've told you multiple times the correct way of getting verified. You do not seem to be listening or understanding. If you attempt to spam your way to voice verification again, you will be denied the privilege indefinitely

[coarse hearth]

:incoming_envelope: :ok_hand: applied voice ban to @misty sinew until 2021-04-13 15:04 (13 days and 23 hours).

[proven shale]

lol

[misty sinew]

._.

i give up

this is a dictatorship

[mild flume]

Only if you're unwilling or unable to follow the rules

[sleek parrot]

@golden marsh check this one

[misty sinew]

you're admitting it is a dictatorship :/

[mild flume]

I think technically it's an oligarchy? But yes. Yes I am

[misty sinew]

i'm amazed

[mild flume]

Why? It's simple, you follow the rules or you accept the consequences for not doing so

[misty sinew]

i'm following the rules

!voice verification

[coarse hearth]

Voice verification

Can’t talk in voice chat? Check out #voice-verification to get access. The criteria for verifying are specified there.

[jaunty shadow]

Spamming is not allowed by the rules.

[misty sinew]

...

':D

ok i'm dumb

[mild flume]

So to clarify, no, you weren't following the rules. And I even told you and warned you about it multiple times before I temp voice banned you

[misty sinew]

i'll wait 2 weeks, rightly so

just to say it, it's the 20th message :).

I NEVER GIVE UP

[misty sinew]

i didn't get it

every person who give up is a loser

i think i'm not a loser

(i think)

who can explain me variables?

i can't get them

[mild flume]

I mean at this point give me one good reason not to just make it permanent

[misty sinew]

i want learn

[short isle]

What do you want to know about variables?

[misty sinew]

.

[misty sinew]

i know you're a good person

❤️

[proven shale]

Variables hold values and objects

alias for memory location, where your thing is stored

[sleek parrot]

hackers 🙂

[short isle]

😆

[misty sinew]

i learned they are like drawers can hold, as you say, values and objects, but what is their meaning, i mean i can literally write every single value, OOOOOOOOOOHHHHHHHHHHHHHHH I GET THEM, I GET THEM BY MYSELF I'M A MISUNDERSTOOD GENIUS, IT'S MORE SIMPLE USE VARIABLES THAN WRITE EVERY SINGLE VALUE, thanks demm

[proven shale]

They indeed act as drawers which can hold values and objects, by values, I mean, datatypes, like integers, floats, characters, strings, etc. By objects I mean complex data types (they are also called user defined datatype), they are instances of classes.

[misty sinew]

my question was what's the meaning of variables but i get it, what they are for I know

[hearty heath]

That's kind-of right. Although it's better to think of them as references to objects. Numbers, strings, dictionaries, lists, etc. are all objects. Objects exist on 'the heap', and a variable is like name given to an object so that you can access it. This is important when you consider that you can have two variables that refer to the same object.

[proven shale]

variables literal meaning is something that can vary

[hearty heath]

For example, what do you expect the output of this code to be? ```py
xs = [1, 2, 3]
ys = xs
ys.append(4)
print(xs)

[proven shale]

meaning you can change them, but you can make them constant which might confuse you?

[steep fiber]

!names

Well, that’s huge, but worth a read

Especially Ned’s talk linked on the bottom

[misty sinew]

are they that important?

[steep fiber]

Variables?

[hearty heath]

Pretty essential yeah.

[misty sinew]

yes

!variables

[hearty heath]

Btw, hey Vester 👋

[steep fiber]

Heyo 👋

[misty sinew]

@hushed spire chat 1 minecraft isn't a game, it's a life choice

my first mode was stoneblock 2

[proven shale]

Well, doesn't that depend on programming language, for example, in python everything is an object and hence variables hold references whereas in languages like c or java, primitive datatypes are held as it is?

[last parcel]

@prime phoenix any reason why you are spamming here?

[misty sinew]

it's like me, it is misunderstood genius

(i'm joking)

i think he/she spamming because is foreign, so it doesn't matter of ban

another time like me

[crystal halo]

!mute 821321017838010418 1d I'm not sure why you're spamming the moment you join, but.. don't.

[coarse hearth]

Bad argument

Member "821321017838010418" not found.

[crystal halo]

Well they left

[misty sinew]

!tempmute DEATH 1y

has someone a free guide to learn informatics languages?

maybe with exercises

!voice verification

[coarse hearth]

Voice verification

Can’t talk in voice chat? Check out #voice-verification to get access. The criteria for verifying are specified there.

[misty sinew]

Have been active for over 3 ten-minute blocks. This means you need to have sent your messages over a span of at least 30 minutes. DUDE IS IT REAL?

IT'S AN AGONY

[unique raptor]

you need to active for 10 mins x 3

[misty sinew]

?

what's mean

[peak frigate]

it's also a minimum of 3 days
but if you received a voice ban earlier, it will be even longer than that. i think you're at 2 weeks

what this means, is that you can chill, relax, listen, ask questions, don't complain

[misty sinew]

it says i have to sent messages over a span of 30 minutes, it's means (50 messages)*(30 minutes waiting each one) = A LOT OF TIME TO WAIT

so i must wait to speak

[unique raptor]

yes

[misty sinew]

2 weeks because there's a ban..... . _ .

[golden marsh]

the 30 minutes is only the time range

in total you need 50 messages spread over a span of 30 minutes

[misty sinew]

I'VE COMPLETED THE QUEST OF 50 MESSAGES IN A CONVERSATION, I'M PROUD OF MYSELF

Mr. Hemlock i'm coming

[unique raptor]

chill

m8 if you yell at the staff it wont fix it

just chill

[misty sinew]

i won't chill i'll plan my plan to conquer this server

[unique raptor]

good luck

you will need it

[misty sinew]

a dictatorship can be won only from a dictatorship

[proven shale]

this server ain't a kingdom or something?

[misty sinew]

sorry ✨ oligarchy✨

[misty sinew]

i'll create one

[peak frigate]

hi jake

i saw your hi earlier

hi x2

[misty sinew]

i'll remember it bro ❤️

Hemlock is my friendly enemy

i'll beat him with knowledge

WHY WAITING IS SO STRESSFUL

2-WEEKS

IT'S A LOT OF TIME

┬─┬ ノ( ゜-゜ノ)

what did the baby corn say to the mama corn?

Where's my popcorn

i-want-talking-with-you-all-❤️

how much time is 2 weeks

i don't want calculate it

BUT IT'S A LOT DUDES

i mean, try u to wait 2 weeks and tell me if it isn't an agony

[unique raptor]

did you get a vc ban

[misty sinew]

yep

[unique raptor]

well you have to wait

[misty sinew]

it's too much time...

[unique raptor]

and why did you get ban

[unique raptor]

yea that is why you follow the rules

[misty sinew]

i tried to evade the law

but i failed

[unique raptor]

well have you learned your lesson

[misty sinew]

yeah

mr. hemlock is racist towards cats

[unique raptor]

and aslo that is ban evasion
that is tos in disocrd

[misty sinew]

tos?

what's mean

[unique raptor]

Terms of service

https://discord.com/terms

https://discord.com/guidelines

[misty sinew]

WHO READS TERMS OF SERVICE OF ANY APP?

[warm tendon]

it was a tempban iirc

[unique raptor]

many people

[misty sinew]

did u really read it

[unique raptor]

yes

[mild flume]

I have

[misty sinew]

congratulation

BAN HIM, HE SAID F WORD

[warm tendon]

🤔

[misty sinew]

fu...

he can't say it

[true valley]

https://support.privacy.com/hc/en-us

https://www.youvisit.com/tour/louvremuseum

[misty sinew]

mr. sherlock why I can't tag everyone in a message

[unique raptor]

well think about it for a sec

[mild flume]

Because it's a server of 169k

And that would be irritating

[misty sinew]

there's an option?

[mild flume]

In the server settings, yeah

[misty sinew]

is there a spokesman from here to voice chat :3

i've to send a message

" I state, I am Italian, and here say a swear-word with "god" it's a big sin, my question is, why you all say "Oh my fuc*** god"? "

this is the message

[maiden wolf]

hi all

[old prawn]

hello bro

[stoic bluff]

hello bro

how are you

nothing much

im doing some homework

i have a lot of bg noises from my end

why wont you talk in chat?

i mean in text-chat

fine then

nothing actually

whacha doing rn?

in which language you're developing your app?

not sure whats that but ok 😂

what app is it?

which country do yo live in?

Finland

no idea

look, now some ppl went to vc0

[ionic crater]

hah DIKtionary

[misty sinew]

hi guys I just woke up

[fluid pumice]

def find_legendary(data):
    line_list = [i.split(',') for i in data]
    legendary_data = []

    for item in line_list:
        if 'TRUE' in item:
            pokemon_name = item[1]
            pokemon_number = item[0]
            pokemon_generation = item[10]
                for i in range(len(name):
                    print(f'{number[i]:<9}{name[i]:<25}{generation[i]:>11}')
            legendary_data.extend([[pokemon_number, pokemon_name, pokemon_generation]])
    return legendary_data```

---

          Legendary Pokemon              

---

Number Name Generation

144 Articuno 1
145 Zapdos 1
146 Moltres 1
150 Mewtwo 1
150 Mega Mewtwo X 1
150 Mega Mewtwo Y 1
243 Raikou 2
244 Entei 2
245 Suicune 2

---

          Legendary Pokemon

---

Number Name Generation

[ancient whale]

multi lines
"""```

[misty sinew]

what type of code is that?

here is my colony coding </>

there is 1 Easter egg

[ancient whale]

it was an example

[misty sinew]

Ohhhh

[misty sinew]

@brittle valley don’t repeat to unmute

[stoic bluff]

@final folio is voice spamming

[misty sinew]

should I ping admins?

[final folio]

Sorry my iPad is being weird

[stoic bluff]

yeah right

[final folio]

I’m just gonna delete discord and re download it

[misty sinew]

should I ping?

[stoic bluff]

to who?

[misty sinew]

admins

That @final folio s voice spams

[stoic bluff]

okey

[misty sinew]

<@&267628507062992896>

[stoic bluff]

its kinda annoying

whenever i join a VC

[misty sinew]

@final folio is voice spamming

[ancient whale]

I kept saying earlier to that guy to "just make a decision" but if its discord screwing up, I'm not suprised either

it randomly closed earlier today

[mild flume]

For moderation stuff, you need to ping mods rather than admins

Or send a DM to the @crisp hazel bot

[misty sinew]

Thank You, @mild flume !

<@&267629731250176001> @final folio is voice spamming

[narrow needle]

Your instruction was to send a DM to the @crisp hazel bot

Sorry--I misread

However I don't see them in a voice channel at the moment.

[misty sinew]

0h

[narrow needle]

Can you explain what you mean by voice spamming?

[stoic bluff]

whenever im in one of the vc's, he keeps leaving and joining back

[narrow needle]

He explained that he was having technical difficulties with the Discord client.

[ancient whale]

ahh shit just had a nose bleed

[stoic bluff]

damn bro

[ancient whale]

even now they freak me out

[misty sinew]

Guys I woke up

[ancient whale]

nice

I'm still here

[misty sinew]

guys how do i get voice verified

cause its hard

it says u need to send minimum 50 msgs

i already sent i think, cause its been more than 5 days that i have been here

[verbal fjord]

helo

[misty sinew]

I have lost voice.

So I will not talk

[verbal fjord]

RiP

I can't speak even if i wanted to

[misty sinew]

then stop

use the symbol in the front of my name

so we can revive michigun

[exotic iron]

Hello, i need some help with some arrays and getting some coordinates

[verbal fjord]

yea?

@misty sinew do u play ches?

[misty sinew]

No

[verbal fjord]

Δ

[misty sinew]

Yes please

I do m i c h i g u n

[exotic iron]

i tried to google before but i found nothing
I have a text file, and i read x coordonates and y coordonates, and i want to create the points for that
i have the coordonates stored as x and y
and i want to have Xi[xi,yi]

[misty sinew]

I have a doubt.

on what do you want to create it

?

[exotic iron]

i want to create it , instead of make.blobs function
for an AI and ML exercise

[misty sinew]

can i ask something

[exotic iron]

to have datasets for perceptron

[misty sinew]

so on a GUI screen

[exotic iron]

anything

[misty sinew]

if you use tkinter you can use i think you can use grid function on a canvas screen

[exotic iron]

not on a GUI screen

[misty sinew]

so i have a project done like that

i used a list and tuples to do that

[exotic iron]

so in a tuple i can store X[x,y]

?

[misty sinew]

i mean

can you give me 3 cordis

[exotic iron]

can i call you to show you

[misty sinew]

Yes

[ancient whale]

#voice-verification ?

[misty sinew]

get non-deleted 50 messages

[stuck bluff]

https://youtu.be/2yckqyg75oE

re: Kids asking "Why?"

[true valley]

https://en.wikipedia.org/wiki/Special:Random

[knotty solar]

ok, its 7pm here, and if I don't go for a walk, my legs are gonna stop working

see you guys later 👋

[mild flume]

https://github.com/mhxion/awesome-discord-communities/#css

[hearty heath]

Yo 👋

Double plus un-good

Yeah, we were talking about linguistic determinism

Same for William 👀

I mean as a term for anatomy 😄

Like, how did that happen?

I really want to use the word "y'all" because it seems kind of useful.

But I would sound ridiculous saying it as a Brit 😄

[elder wraith]

Needs southern accent

[mild flume]

!voice @abstract hatch If you're wondering why you can't talk, check out this channel. That should tell you what you need to know

[coarse hearth]

Voice verification

Can’t talk in voice chat? Check out #voice-verification to get access. The criteria for verifying are specified there.

[abstract hatch]

ah ok thanks for that 🙂

[mild flume]

No problem!

[last parcel]

Oh hey, that's a bisk

[mild flume]

And he's hiccuping

And it's far funnier than it should be

@fair heart Every time bisk hiccups

[raven orbit]

All the golden oldies in one vc

Perhaps I shall join

[open osprey]

have a python question - not to interrupt the breathing conversation

[peak frigate]

lol pls interrupt

[open osprey]

does anyone else have problems with pip3 install psycopg2

[hearty heath]

Wow, rude 😄

[raven orbit]

Were you there when I said it?

[open osprey]

i usually resort to psycopg2-binary but I want to download the package for an aws lambda package

[hearty heath]

Nah

Ah, that's not a good sign.

I'm looking up persistent hiccups on WebMD and the prognosis isn't good...

Basically, you have cancer

[peak frigate]

omg lol

[hearty heath]

hahaha Opal

The Netherlands is a testament to human stubbornness.

👀

[sleek parrot]

https://en.wikipedia.org/wiki/File:The_Netherlands_compared_to_sealevel.png

https://en.wikipedia.org/wiki/Flood_control_in_the_Netherlands#:~:text=The Zuiderzee Works (Zuiderzeewerken) are,Zuiderzee from the North Sea.

[raven orbit]

https://en.wikipedia.org/wiki/Schokland

this is the place we went yesterday

which used to be an island

[mild flume]

https://en.wikipedia.org/wiki/Bone_conduction

[open osprey]

anyone have any bot scripts for ps5?

want to buy one

I keep getting beat - lol just want to buy myself one

resellers

[fair heart]

https://www.youtube.com/watch?v=NNZscmNE9QI

[open osprey]

lol

what's the advantage with the bot? add to cart?

[fair heart]

look at the video

[knotty solar]

so sad

@mild flume I ctrl + c something in excel, it gets ctrl + v only one time
any way to paste it multiple times?

[stuck bluff]

"So, everyone, this is Mrs. Hemlock."
"Hey, Mrs. Hemlock, it's lovely to meet you. Mr. Hemlock has told us so much about you. All good things. All good things..."

[open osprey]

hemlock do you have any experience with aws and python? specifically deploying lambda packages?

👍

[mild flume]

#tools-and-devops

[stuck bluff]

Russian ovine affirmatives.

[raven orbit]

https://en.wikipedia.org/wiki/Caprine

[open osprey]

building refined ps5 bots

joking of course

[mild flume]

!rule 5

[coarse hearth]

Rules

5. Do not provide or request help on projects that may break laws, breach terms of services, be considered malicious or inappropriate. Do not help with ongoing exams. Do not provide or request solutions for graded assignments, although general guidance is okay.

[open osprey]

figuring out my aws problems

should i get a switch while i wait

heard its awesome

[native vapor]

You could always extract the first row and use a dictionary of key value pairs to more cleanly loop the information and place it in your output data structure. I've just found using positional array values doesn't lend well when you want to understand your code later.

[solar wharf]

someone knows flask and can help me <?

[mild flume]

@solar wharf I personally don't but you might ask in #web-development. They'd be the folks to ask

[native vapor]

I use it some

[native vapor]

Great for testing out REST APIs and collecting from Webhooks

[mild flume]

@unkempt rock Thank you

[native vapor]

haha

Yeah, eventually I will have rights

I love Django

It's harder than flask

@olive sable Yeah, are you collecting bots that are online with Django?

their status and then sending messages

Yeah

not that complicated

haha

@olive sable sounds like a nice thing to build as an event driven architecture, good use case of queuing and priorities

@olive sable yeah, send your messages to Kafka and then handle things from there...

I wish I could talk lol

[olive sable]

I have no idea what Kafka is

[native vapor]

It's not a hard thing to do

it's a messaging system to handle the flow of diff informational messages

[olive sable]

using what database? I am using postgres

[native vapor]

I can wait

yesterday

flask

@elder wraith so what would u use to harvest webhooks?

FastAPI?

that's interesting

[olive sable]

https://docs.djangoproject.com/en/3.1/topics/forms/formsets/

[native vapor]

um...

So a webhook essentially is tripped by an event then hits an API

no, collection point

that's what I asked

I aggree

it's bloated af

Flask isn't as bad, but what you said is worth looking into for me

yeah...I'm dockerizing that now

It's a savage beast

from flask import Flask, jsonify, request
from flask_restful import Api, Resource

app = Flask(__name__)
api = Api(app)

class HelloWorld(Resource):
    def get(self):
        return {'data': 'Hello World'}

api.add_resource(HelloWorld, '/helloworld')

if __name__ == "__main__":
    app.run(debug=True)

flask...easy mode

[pearl torrent]

whats being streamed?

[mild flume]

Oh it was us trying to help him figure out a pathing issue

[native vapor]

Pycharm

Pycharm is sooooo goood

JetBrains 100%

I love the debugger

[vivid acorn]

Just dont google, at least use Duck jeje

[true valley]

So Ruffle project.

[vivid acorn]

aww

[true valley]

This is how Homestarrunner.com ported his flash code over.

https://ruffle.rs/

[olive sable]

if anyone has any experience with Django and wants to come help me out jump into Code/Help0

[native vapor]

Well that's good...

[ancient whale]

#voice-verification

[stone flume]

i wait for PytonLaTeX

because there is only LuaLaTeX

[ancient whale]

https://pyweek.org/e/lua-sucks/

[ancient whale]

https://pypi.org/project/PyLaTeX/

[stone flume]

my got

let's take a look

thanks !

[shrewd star]

NOW I AM BECOME DEV, HELLOER OF WORLDS!

[ancient whale]

https://www.reddit.com/r/funny/comments/591wvh/pingu_destroyer_of_worlds/

https://www.coolmathgames.com/0-worlds-hardest-game

[ancient whale]

dictionary = { "input" : "output"}

dictionary["input"] would return "output"

[gleaming crow]

ehre

[hearty heath]

Er @shrewd star you've got some background noise coming through.

Yep 😄

[gleaming crow]

so am i allowed to post the code here?

[hearty heath]

Yep!

[gleaming crow]

with '''

[ancient whale]

use three `

[hearty heath]

!code

[coarse hearth]

Here's how to format Python code on Discord:

```py
print('Hello world!')
```

These are backticks, not quotes. Check this out if you can't find the backtick key.

[gleaming crow]

    num1 = int(input("Enter a number: "))
    counter = 0
    for i in range(1,num1+1):
        print(i)
        counter += 1
    return counter 
main()```

[shrewd star]

```py
print("Hello world!")
```

[gleaming crow]

so i was wondering how i can just get counter without the main

[shrewd star]

code block no worky :/

[gleaming crow]

like what does the return do in this case

[shrewd star]

i did exactly that

[gleaming crow]

i know you can save a value with return

wait

what

can u explain it a little

like waht if i same the main function as a x variable

[hearty heath]

@gleaming crow I think you may have just met the requirements for voice-verification. Try it out in the #voice-verification channel.

[gleaming crow]

really

[ancient whale]

  return 1
var = a()
# var now holds a 1
a()
#but calling a() without putting it into a variable, just gets ignored```

[hearty heath]

You can talk now 😄

[gleaming crow]

its still supressed

[hearty heath]

Try leaving and joining.

[gleaming crow]

lol

[hearty heath]

Too much information

@shrewd star can you turn on PTT please.

[ancient whale]

var = main()

    num1 = int(input("Enter a number: "))
    counter = 0
    for i in range(1,num1+1):
        print(i)
        counter += 1
    return counter 
counter = main()
#so its in var "counter"```

[hearty heath]

Wow, what causes them?

Ohh right ok.

Yep

[hearty heath]

As long as it's not obscene or spammy.

[shrewd star]

code:

class struct(object):
 def __init__(self,**k):[setattr(self,this,that)for this,that in k.items()]
 def __getattr__(self,item):
  if not hasattr(self,item):setattr(self,item,self.__class__())
  return object.__getattr__(self,item)
 def __call__(self,f):setattr(self,f.__name__,f);return f
 def __lshift__(s,o):print(0)
cout = struct()
cout.__lshift__=print
print(cout.__lshift__)
cout << 1

expected output:
<builtin function print> 1

actual output:
<builtin function print> 0

[hearty heath]

Oh, you're trying to emulate C++'s cout?

[boreal timber]

[shrewd star]

!e ```py
@lambda c:c()
class cout:lshift=print

cout << "Hello World!"

[coarse hearth]

@shrewd star :white_check_mark: Your eval job has completed with return code 0.

Hello World!

[ancient whale]

def a():
  global var
  var = var +1
a()
print(var) # var is now 11```

[shrewd star]

I legit need help with this struct class tho.
I want the dunders to work after the class statement not within it.
i.e. actual __setattr__ not this weird fake __setattr__ it's doing

[hearty heath]

Oh yeah, it's nice.

[shrewd star]

!e ```py
#this code is supposed to do what it looks like it should do but it doesn't
class struct(object):
def init(self,**k):[setattr(self,this,that)for this,that in k.items()]
def getattr(self,item):
if not hasattr(self,item):setattr(self,item,self.class())
return object.getattr(self,item)
def call(self,f):setattr(self,f.name,f);return f

cout = struct()
cout.lshift=print
print(cout.lshift) # confirm
cout << 1 # error here

[coarse hearth]

@shrewd star :x: Your eval job has completed with return code 1.

001 | <built-in function print>
002 | Traceback (most recent call last):
003 |   File "<string>", line 12, in <module>
004 | TypeError: unsupported operand type(s) for <<: 'struct' and 'int'

[ancient whale]

https://processing.org/

[shrewd star]

!e ```py
class f:pass
f.add=print
f+"Hello World!"

[coarse hearth]

@shrewd star :x: Your eval job has completed with return code 1.

001 | Traceback (most recent call last):
002 |   File "<string>", line 3, in <module>
003 | TypeError: unsupported operand type(s) for +: 'type' and 'str'

[shrewd star]

That's the problem in a nutshell

[ancient whale]

pip install pygame

[hearty heath]

They're java build tools

[ancient whale]

https://processing.org/

[shrewd star]

im dum

[misty sinew]

can anyone tell me where i can get help?

for some python things?

[hearty heath]

Electron?

[shrewd star]

!e ```py
import ctypes # noooooooooooooooooooo
class struct:
def init(self,**k):[setattr(self,this,that)for this,that in k.items()]
def getattr(self,item):
if not hasattr(self,item):setattr(self,item,self.class())
return object.getattr(self,item)
def setattr(self,key,item):
hack=ctypes.py_object.from_address(id(self)+8)
if not hasattr(self,'gulag'):hack.value.gulag=hack.value
hack.value=type(hack.value.name,(hack.value,),{key:item})
def call(self,f):setattr(self,f.name,f);return f
def del(self):
if hasattr(self,'gulag'):ctypes.py_object.from_address(id(self)+8).value=self.gulag
cout = struct(lshift=print)
derp = struct(derp=None)
cout << dir(cout)

[peak frigate]

@hearty heath the ducksies ... so cute

[hearty heath]

Yep 😄

[shrewd star]

!e ```py
@lambda c:c()
class cout:lshift=print
cout << "this is c++ lol"

[coarse hearth]

@shrewd star :white_check_mark: Your eval job has completed with return code 0.

this is c++ lol

[shrewd star]

This is the ultimate goal of this class:

from cursedutils.cursed import struct
struct._bootstrap(globals())

cout.__lshift__ = print
output.data.x = 3
output.data.y = 4

@lambda f: cout << f(output.data)
def main(data):
  return data.x * data.y

assert 'data' not in dir(cout)

[ancient whale]

{
    long i;
    float x2, y;
    const float threehalfs = 1.5F;

    x2 = number * 0.5F;
    y  = number;
    i  = * ( long * ) &y;                       // evil floating point bit level hacking
    i  = 0x5f3759df - ( i >> 1 );               // what the fuck? 
    y  = * ( float * ) &i;
    y  = y * ( threehalfs - ( x2 * y * y ) );   // 1st iteration
//    y  = y * ( threehalfs - ( x2 * y * y ) );   // 2nd iteration, this can be removed

    return y;
}```

https://en.wikipedia.org/wiki/Fast_inverse_square_root

[waxen moon]

https://youtu.be/NeXMxuNNlE8

[fluid edge]

ruh oh

[shrewd star]

!e print(0x5f3759df)

[coarse hearth]

@shrewd star :white_check_mark: Your eval job has completed with return code 0.

1597463007

[shrewd star]

@ancient whale i wanna playtest it :/

it sounds fun :>

[ancient whale]

Ill send files as soon as I beat the level I just made

I've had to add some check points..

[shrewd star]

it lets me join the vc but i cant hear you

@ancient whale

[ancient whale]

oh shit dude

well I'm almost done packing game just need a licence file

[shrewd star]

can you hear me?

[ancient whale]

nope

[shrewd star]

i connected bluetooth headphones

i can hear you

but you cant hear me

nope cant hear you

[ancient whale]

sending game to you

[shrewd star]

k

[ancient whale]

ok uploading it now, I'll PM you a file.re download link

Sent!

can you not hear me ?

[misty sinew]

hi im back

british?

i want to continue coding museum

well i hate being extinct

it's dangerous

yet that makes me dead if i smell an extinct fog

im using headphones

[misty sinew]

what-

they've gone extinct or no?

i will play funky friday in roblox XD

yet i want to spit-alung-off-will speed-over-aheadless run.

really impossible

gg! won

[misty sinew]

poopcolate

LOL

[ancient whale]

https://www.7-zip.org/

[shrewd star]

what can cause this?

it's a .webm file

[ancient whale]

that might be why

[shrewd star]

it worked before

like years ago

https://cdn.discordapp.com/attachments/743183995973402756/763068067109666866/waffle.webm

[ancient whale]

theres no image now!

[ancient whale]

IT DOESNT END

[ancient whale]

ITS GONE

[ember tide]

lol

[ancient whale]

Its gone

the placeholder or iframe is gone

[ember tide]

kkk

[shrewd star]

who needs a desktop background?

when you can just fullscreen a script?

[ember tide]

it says i have to send more than 50 messages

lol okay

thank you btw

[misty sinew]

i have to do extreme by-speed-along run

[shrewd star]

!e @ancient whale I made your discord... ```py
print (f"{57005:X}")

[coarse hearth]

@shrewd star :white_check_mark: Your eval job has completed with return code 0.

DEAD

[shrewd star]

XD

[misty sinew]

restart your discord

what did you do to lua sucks

[ancient whale]

#esoteric-python message

cmatrix -ab -C red

[strong bone]

Will do :)

[ancient whale]

#voice-verification

[strong bone]

I guess I still have some requirements to first take care of.
New to this server

Ohhh definitely. Hoping to chatting one day

[shrewd star]

I started learning python last year

[ancient whale]

nice

have you got to speen yet?

[fluid pumice]

def find_legendary(data):
    line_list = [i.split(',') for i in data]
    legendary_data = []
    for item in line_list:
        if 'TRUE' in item:
            pokemon_name = item[1]
            pokemon_number = item[0]
            pokemon_generation = item[10]
            legendary_data.extend([[pokemon_number, pokemon_name, pokemon_generation]])        
    return legendary_data

def find_strength(data):
    line_list = [i.split(',') for i in data]
    gensix_data = []
    line_list.pop(0)
    for item in line_list:
        if int(item[10]) == 6:
            pokemon_name = item[1]
            strength_sum = 0
            for  i in range(4,10):
                strength_sum += int(item[i])
            gensix_data.extend([[pokemon_name, strength_sum]])
    return gensix_data

def find_ability(data):
    line_list = [i.split(',') for i in data]
    gen1_list = []
    line_list.pop(0)
    for i in range(len(data)):
    line = data[i].rstrip().replace('[','').replace(']','').replace("'",'')  
    # .rstrip() removes any whitespace on the right side of the line
    # .replace(a,b) replaces a with b
    line_list = line.split(',')     # Now create list of line elements
    if line_list[10] == '1':        # Then check to see whether Pokemon is Gen 1
        gen1_list.append(line_list) # If Gen 1, append to gen1_list```

def main():
    with open('pokemon_13.csv', 'r') as f:
        data = f.readlines()
    legendary_pokemon = find_legendary(data)
    print('---------------------------------------------')
    print('              Legendary Pokemon              ')
    print('---------------------------------------------')
    print('Number      Name                   Generation')
    print('---------------------------------------------')
    for item in legendary_pokemon:
        print('{:<9}{:<25}{:>11}'.format(item[0],item[1],item[2]))
    gensix = find_strength(data)
    print('------------------------------------------------------------------')
    print('            Pokemon Generation 6 Strength [* = 20 pts]            ')
    print('------------------------------------------------------------------')
    for item in gensix:
        points = item[1] // 20
        strength = ''
        for i in range(points):
            strength += '*'
        print('{:>24}    {:<37}'.format(item[0], strength))```

for item in line_list:
        if line_list[10] == '1':        
            pokemon_name = item[1]
            pokemon_number = item[0]
            pokemon_ability = item[12]```

[ancient whale]

for item in legendary_pokemon:
        print('{:<9}{:<25}{:>11}'.format(item[0],item[1],item[2]))```

[fluid pumice]

def find_ability(data):
    gen1_list = []
    line_list.pop(0)
    for i in range(len(data)):
    line = data[i].rstrip().replace('[','').replace(']','').replace("'",'')  
    # .rstrip() removes any whitespace on the right side of the line
    # .replace(a,b) replaces a with b
    line_list = line.split(',')     # Now create list of line elements
    for item in line_list:
        if line_list[10] == '1':        
            pokemon_name = item[1]
            pokemon_number = item[0]
            pokemon_ability = item[12]
            gen1_list.extend([[pokemon_number, pokemon_name, pokemon_ability]])
    return gen1_list 
        ```

[ancient whale]

pokemon_ability = item[12].rstrip().replace('[','').replace(']','').replace("'",'')

    gen1_list = []
    line_list.pop(0)
    for i in range(len(data)): #????????????????????
    line =  data[i].rstrip().replace('[','').replace(']','').replace("'",'')  
    # .rstrip() removes any whitespace on the right side of the line
    # .replace(a,b) replaces a with b
    line_list = line.split(',')     # Now create list of line elements
    for item in line_list:
        if line_list[10] == '1':        
            pokemon_name = item[1]
            pokemon_number = item[0]
            pokemon_ability = item[12].rstrip().replace('[','').replace(']','').replace("'",'')
            gen1_list.extend([[pokemon_number, pokemon_name, pokemon_ability]])
    return gen1_list ```

[stoic bluff]

hello

ok

which game

yes i have heard of it before

nice

[misty sinew]

I have a broken teeth AAAAAAAA

[shrewd star]

@ancient whale
https://www.youtube.com/watch?v=7f8kahmsJ-s

[misty sinew]

I have a broken teeth

it just broke by its own

I don’t have a medical supply

[knotty solar]

how old r u?

[misty sinew]

ok stop

let’s stop asking age questions

let’s just relax

[knotty solar]

you're not super young right?
kids lose their milk teeth

[misty sinew]

I will go stop talking

[maiden wolf]

😆

[misty sinew]

Kids laugh so much

[maiden wolf]

i believe i could produce another kid just like you

who will not laugh

sorry i probably should not talk to a kid like that

my bad

[stoic bluff]

gorilla

https://tenor.com/view/funny-animals-walking-gorilla-ape-gif-11409190

[misty sinew]

I want to go to brazil 🇧🇷

[stoic bluff]

https://tenor.com/view/you-are-going-to-wasteland-gif-19275613

[ocean meteor]

yeah

i have to verify myself first

[pastel nimbus]

pog

[stoic bluff]

[proven shale]

that was some real nice music

[stoic bluff]

https://tenor.com/view/dance-kid-club-gif-9152583

[ancient whale]

https://tenor.com/view/willem-dafoe-laugh-crazy-car-close-up-gif-12180194

[stoic bluff]

xD

[misty sinew]

when the impasta is s** o**s!

[ocean meteor]

lol

[stoic bluff]

amogus

https://tenor.com/view/19dollar-fortnite-card-among-us-amogus-sus-red-among-sus-gif-20549014

[pastel nimbus]

sus

[misty sinew]

buitit

sus red

[pastel nimbus]

https://tenor.com/view/enojado-el-increíble-mundo-de-gumball-furioso-enfadado-harto-gif-20971192

[stoic bluff]

@shrewd star what in da fuck u listening?

[misty sinew]

https://tenor.com/view/tesseract-dimension-gif-11731956

imagine this

[proven shale]

a tesseract

[stoic bluff]

4d

cube

[knotty solar]

you can make this on paper too

[ocean meteor]

yeah its rotating

[proven shale]

but in the 4th dimension

[pastel nimbus]

https://tenor.com/view/templeos-terry-davis-gif-19184988

[misty sinew]

https://tenor.com/view/among-us-gif-18676023

Amogus be like

[stoic bluff]

you sussy

[knotty solar]

fun fact, its just rotating
its a 3d representation of a 4d figure
we actually can't see a 4d figure 😄

[pastel nimbus]

oo

[ocean meteor]

that is displayed on a 2d screen

[proven shale]

exactly ^

[misty sinew]

Your question mark is n

[pastel nimbus]

templeos superior language

[ocean meteor]

lol

[stoic bluff]

damn facts

https://tenor.com/view/terry-davis-temple-os-terryadavis-temple-gif-12601073

[pastel nimbus]

rip terry you will be missed

[shrewd star]

oh no my pc doesn't recognise my headphones

[misty sinew]

Guys

[ocean meteor]

sad

[misty sinew]

Goodnight I’m gonna sleep

[ocean meteor]

the guy who made templeOS^

[pastel nimbus]

goodnight viz

[ancient whale]

https://www.youtube.com/watch?v=UCgoxQCf5Jg

[proven shale]

gn

[ocean meteor]

yeah i have seen it

[misty sinew]

I will stay at call

[pastel nimbus]

i've heard of him, the legendary cod player himself

[stoic bluff]

good for you

[ancient whale]

https://www.youtube.com/watch?v=LNHbm7GBHwg

[pastel nimbus]

ye

[misty sinew]

One more question

[knotty solar]

this is some heavy stuff, oof

[misty sinew]

I will hide my device and listen

[stoic bluff]

@ancient whale of what?

[pastel nimbus]

he's an interesting guy

lmao it;s wak

[stoic bluff]

haha wtf

[misty sinew]

I will wake up at 3:00

Ahh shot

[shrewd star]

https://tenor.com/view/cat-white-roomba-cute-weird-gif-19060101

[pastel nimbus]

majestic

[knotty solar]

imagine that running around your house 😂

people seeing it

[misty sinew]

https://tenor.com/view/fly-flying-hover-gif-12819512

imagine that is in your backyard

[knotty solar]

fakeCoin
realCoin
or coinFake
coinReal
starts with c

[shrewd star]

https://tenor.com/view/yangxiaolonger-cat-hide-on-trash-can-gif-11939968

[misty sinew]

||’fakecoin’||

||coin real and coin fake||

[knotty solar]

I thought you were going to sleep 🤔

[misty sinew]

Ok I gotta sleep

[ocean meteor]

XD

[proven shale]

lol

[knotty solar]

_____ = True
def ____(_):
    ______ = False
    if _ in {2,3}:
        return _____
    elif _ < 2 or _ % 2 == 0 or _ % 3 == 0:
        return ______
    ___ = 5; __=2
    while ___**2 <= _:
        if _ % ___ == 0:
            return ______
        ___ += __;__ = 6 - __
    return _____

[ancient whale]

#esoteric-python message

[shrewd star]

https://tenor.com/view/do-you-have-games-on-gif-20619390

[proven shale]

you like cats?

[stoic bluff]

jesus that looks scary O_O

[proven shale]

Thats beautiful

and disgusting at the same time

[pastel nimbus]

dayum

[ancient whale]

__=(((_<<_)<<_)*_)
__import__(('c%'[::(([]!=[])-(()==()))])*((_<<_)+(()==()))%((__+(((_<<_)*_)+((_<<_)+((_*_)+(_+(()==())))))),(__+(((_<<_)*_)+((_<<_)+((_*_)+(_+(()==())))))),(__+(((_<<_)<<_)+(_<<_))),(__+(((_<<_)<<_)+((_*_)+(()==())))),(__+(((_<<_)<<_)+((_<<_)+(_*_)))),(__+(((_<<_)<<_)+((_<<_)+(_*_)))),(__+(((_<<_)<<_)+((_<<_)+((_*_)+(_+(()==())))))),(__+(((_<<_)*_)+((_<<_)+((_*_)+(_+(()==())))))),(__+(((_<<_)*_)+((_<<_)+((_*_)+(_+(()==())))))))) ```

[knotty solar]

😱

[pastel nimbus]

EW

[ocean meteor]

wow

[knotty solar]

!e

_=((()==())+(()==()))
__=(((_<<_)<<_)*_)
__import__(('c%'[::(([]!=[])-(()==()))])*((_<<_)+(()==()))%((__+(((_<<_)*_)+((_<<_)+((_*_)+(_+(()==())))))),(__+(((_<<_)*_)+((_<<_)+((_*_)+(_+(()==())))))),(__+(((_<<_)<<_)+(_<<_))),(__+(((_<<_)<<_)+((_*_)+(()==())))),(__+(((_<<_)<<_)+((_<<_)+(_*_)))),(__+(((_<<_)<<_)+((_<<_)+(_*_)))),(__+(((_<<_)<<_)+((_<<_)+((_*_)+(_+(()==())))))),(__+(((_<<_)*_)+((_<<_)+((_*_)+(_+(()==())))))),(__+(((_<<_)*_)+((_<<_)+((_*_)+(_+(()==())))))))) 

[coarse hearth]

@knotty solar :white_check_mark: Your eval job has completed with return code 0.

Hello world!

[stoic bluff]

ew

disgusting

exactly

[ocean meteor]

128 language Ouroborous quine

[misty sinew]

This is my pay code

[stoic bluff]

--[------->++<]>-.[->+++<]>.+++++.-----------.+++++++++.+++++++++.+[->+++<]>++.+.--[--->+<]>-.--[->++<]>.--[->++<]>-.+.++[->+++<]>++.+++++.++++++.[->+++++<]>+++.+[--->+<]>+++.++[->+++<]>.>++++++++++..--[----->+<]>+.+++++.++++++.[---->+<]>+++.+[----->+<]>.------------.++++++++.+++++.++[++>---<]>.-----[->+++<]>.+++++.++++++.[---->+<]>+++.[->+++<]>+.--[--->+<]>---.-----------.----.+[->+++<]>.------------.+[->+++<]>.++++++++++++.-.+++++.+.[---->+<]>+++.+[->+++<]>.+++++.-------.--[--->+<]>---.[-->+++++<]>+++.++++++++++.-[--->+<]>--.--[--->+<]>---.-----------.--[--->+<]>-.--[->+++<]>-.++.-[->++++++<]>+.---------.-[->++++<]>-.>++++++++++.-[------->+<]>+.++.---------.+++++.++++++.+++[->+++<]>+.---[->+++<]>-.------.++[->++<]>.-[->+++++<]>++.+++++++..+++.[--->+<]>-----.---[->+++<]>.-[--->+<]>---.---.++++++.--------------.-[--->+<]>.+.+++++++.-[-->+++<]>-.>++++++++++.[------->+++<]>.-------------.[--->+<]>---.+.---.----.-[->+++++<]>-.[-->+++<]>.+++++++++++.>++++++++++.>--[-->+++<]>.

brainfuck code

[ancient whale]

https://github.com/mame/quine-relay/blob/master/QR.rb

[stoic bluff]

of this ```c
#include <stdio.h>
int main(int argc, const char *argv[]) {
printf("Hello Wolrd!");
return 0;
}

[shrewd star]

!e ```py
import('ctypes').py_object.from_address(id(...)+8).value=type("wrapper",(object,),{'call':lambda s,f:f()})
@int
@...
class n:int=lambda s:69
@...
class cout:lshift=print
@...
class main:init=lambda s: cout << int.mul((n//10)*10,(n%10)-(True<<10**False))

[coarse hearth]

@shrewd star :white_check_mark: Your eval job has completed with return code 0.

420

[knotty solar]

they already banned my 2 accounts

[proven shale]

lol

[knotty solar]

I don't ask questions on so anymore

[misty sinew]

My last longest code...

[proven shale]

its april fools btw, dont worry

[shrewd star]

#esoteric-python message
@ancient whale
i tried to make a brainfuck interpreter

this is what happened

[stoic bluff]

who plays old school runescape here?

[misty sinew]

my long code for py....

3.9

[shrewd star]

a=[0]
@lambda cls:cls(1)
class fibonacci(int):
 def __repr__(s):
  a.append(s.__class__(int.__add__((lambda i:print(int(i))or i)(a[-2]),a[-1])))
  return int.__repr__(s)

a+=[fibonacci]
print (a) # in console: >>> a

[stoic bluff]

@ancient whale you probably dont have java installed

[shrewd star]

!e ```py
print ([0x0for O in input("Hello World!")])

[coarse hearth]

@shrewd star :white_check_mark: Your eval job has completed with return code 0.

[15]

[misty sinew]

What’s this code for py? <p style="text-align:left;">Left</p>
<p style="text-align:center;">Center</p>
<p style="text-align:right;">Right</p>
<p><a style="text-decoration:none;" href="//www.html.am">Link with no underline...</a></p>
<p style="text-decoration:underline;">Normal text with underline</p>
<p style="text-decoration:line-through;">Text with a line through the middle</p>
<p style="text-decoration:overline;">Text with an overline</p>
<p style="text-decoration:blink;">Blinking text (doesn't work on all browsers)</p>
<p style="text-indent:18px;width:200px;">The first line of this paragraph is indented by 18 pixels. Each subsequent line is not indented.</p>
<p style="text-indent:2.8em;width:200px;">The first line of this paragraph is indented by 2.8 em. An em defines the proportion of the letter width and height with respect to the point size of the current font.</p>
<p style="text-indent:35%;width:200px;">The first line of this paragraph is indented by 35% (i.e. 35% of the containing block - not this paragraph).</p>
<p style="text-indent:-8px;width:200px;">The first line of this paragraph is indented by a negative amount (-8 pixels). </p>
<p style="font-size:18px;color:orange;text-shadow:1px 1px 1px #666;">Drop shadow 1</p>
<p style="font-size:18px;color:orange;text-shadow:1px 1px 1px #000;">Drop shadow 2</p>
<p style="font-size:18px;text-shadow:4px 4px 4px #666;">Drop shadow 3</p>
<p style="font-size:18px;color:orange;text-shadow:4px 4px 8px #666;">Drop shadow 4</p>
<p style="font-size:18px;color:#fff;text-shadow:1px 1px 8px #000;">Drop shadow 5</p>
<p style="text-transform:capitalize;">capitalized text (also known as title case)</p>
<p style="text-transform:uppercase;">uppercase text</p>
<p style="text-transform:lowercase;">TALK QUIETLY</p>

[shrewd star]

<p style="text-align:left;">Left</p>
<p style="text-align:center;">Center</p>
<p style="text-align:right;">Right</p>
<p><a style="text-decoration:none;" href="//www.html.am">Link with no underline...</a></p>
<p style="text-decoration:underline;">Normal text with underline</p>
<p style="text-decoration:line-through;">Text with a line through the middle</p>
<p style="text-decoration:overline;">Text with an overline</p>
<p style="text-decoration:blink;">Blinking text (doesn't work on all browsers)</p>
<p style="text-indent:18px;width:200px;">The first line of this paragraph is indented by 18 pixels. Each subsequent line is not indented.</p>
<p style="text-indent:2.8em;width:200px;">The first line of this paragraph is indented by 2.8 em. An em defines the proportion of the letter width and height with respect to the point size of the current font.</p>
<p style="text-indent:35%;width:200px;">The first line of this paragraph is indented by 35% (i.e. 35% of the containing block - not this paragraph).</p>
<p style="text-indent:-8px;width:200px;">The first line of this paragraph is indented by a negative amount (-8 pixels). </p>
<p style="font-size:18px;color:orange;text-shadow:1px 1px 1px #666;">Drop shadow 1</p>
<p style="font-size:18px;color:orange;text-shadow:1px 1px 1px #000;">Drop shadow 2</p>
<p style="font-size:18px;text-shadow:4px 4px 4px #666;">Drop shadow 3</p>
<p style="font-size:18px;color:orange;text-shadow:4px 4px 8px #666;">Drop shadow 4</p>
<p style="font-size:18px;color:#fff;text-shadow:1px 1px 8px #000;">Drop shadow 5</p>
<p style="text-transform:capitalize;">capitalized text (also known as title case)</p>
<p style="text-transform:uppercase;">uppercase text</p>
<p style="text-transform:lowercase;">TALK QUIETLY</p>

[stoic bluff]

https://tenor.com/view/tekken-kazuya-ending-gif-4978646

[shrewd star]

!e @ancient whale this magical X thing makes your pc go... ```py
print (f"{57005:X}")