#πŸ€–οΌŽall-bots

1 messages Β· Page 685 of 1

gusty belfry
#

Wb

hexed forumBOT
#
Nagumo goes into battle!
Player team

L. 15 :tiger2: - epicelsythrsprout
L. 15 :dog2: - epicelsythrpr
L. 15 :cat2: - rarergreatswordusafeguard

Enemy team

L. 28 :rabbit2: - no weapon
L. 28 :snail: - no weapon

gusty belfry
#

Wh

hexed forumBOT
#

🌱 | Nagumo, hunt is empowered by egem1[27/75] lgem3[512/800] lgem4[512/800] !
blank | You found: :bee: :beetle: :beetle: :bug: :butterfly: :butterfly: :snail: :baby_chick: :chipmunk: :mouse2: :rooster: :pig2:
blank | :tiger2: :dog2: :cat2: gained 67xp!

gusty belfry
#

Wb

hexed forumBOT
#
Nagumo goes into battle!
Player team

L. 15 :tiger2: - epicelsythrsprout
L. 15 :dog2: - epicelsythrpr
L. 15 :cat2: - rarergreatswordusafeguard

Enemy team

L. 19 gdeer - mythicmbowrwp
L. 19 gsquid - mythicmshieldewgen
L. 19 gspider - no weapon

gusty belfry
#

Wb

hexed forumBOT
#
Nagumo goes into battle!
Player team

L. 15 :tiger2: - epicelsythrsprout
L. 15 :dog2: - epicelsythrpr
L. 15 :cat2: - rarergreatswordusafeguard

Enemy team

L. 15 :rooster: - no weapon
L. 15 :baby_chick: - no weapon
L. 15 :bug: - no weapon

gusty belfry
#

Wh

hexed forumBOT
#

🌱 | Nagumo, hunt is empowered by egem1[26/75] lgem3[506/800] lgem4[506/800] !
blank | You found: :bee: :beetle: :beetle: :butterfly: :butterfly: :butterfly: :snail: :snail: :baby_chick: :mouse2: :rabbit2: :cat2:
blank | :tiger2: :dog2: :cat2: gained 58xp!

gusty belfry
#

Wb

hexed forumBOT
#
Nagumo goes into battle!
Player team

L. 15 :tiger2: - epicelsythrsprout
L. 15 :dog2: - epicelsythrpr
L. 15 :cat2: - rarergreatswordusafeguard

Enemy team

L. 17 :penguin: - epicegreatswordfmag
L. 17 :dog2: - mythicmasceptmmanatap
L. 17 :rabbit2: - epicevbanecritical

gusty belfry
#

Wh

hexed forumBOT
#

🌱 | Nagumo, hunt is empowered by egem1[25/75] lgem3[500/800] lgem4[500/800] !
blank | You found: :bee: :bee: :beetle: :beetle: :bug: :bug: :butterfly: :mouse2: :rabbit2: :cat2: :pig2: :sheep:
blank | :tiger2: :dog2: :cat2: gained 87xp!

gusty belfry
#

Wb

hexed forumBOT
#
Nagumo goes into battle!
Player team

L. 15 :tiger2: - epicelsythrsprout
L. 15 :dog2: - epicelsythrpr
L. 15 :cat2: - rarergreatswordusafeguard

Enemy team

L. 16 :chipmunk: - no weapon
L. 16 :baby_chick: - no weapon
L. 16 :beetle: - no weapon

gusty belfry
#

W pray @foggy slate

hexed forumBOT
#

πŸ™ | @gusty belfry prays for @foggy slate! You feel lucky!
blank | You have 56 luck point(s)!

#

🌱 | YSHINZU_倩使, hunt is empowered by mgem1[61/75] !
blank | You found: :bee: :beetle: :beetle: :beetle: :bug: :butterfly: :cat2:
blank | gdeer gowl gspider gained 26xp!

#
YSHINZU_倩使 goes into battle!
Player team

L. 20 gdeer - mythicmestaffmsprout
L. 20 gowl - mythicpmestaffmlifesteal
L. 20 gspider - mythicmorbmmanatapmdischarge

Krons Killers

L. 21 gspider - mythicmgreatswordewgen
L. 21 :unicorn: - epicehealstaffmpr
L. 21 gowl - epiceshieldrwp

gusty belfry
#

Wb

hexed forumBOT
#
Nagumo goes into battle!
Player team

L. 15 :tiger2: - epicelsythrsprout
L. 15 :dog2: - epicelsythrpr
L. 15 :cat2: - rarergreatswordusafeguard

Team Rocket

L. 22 glion - mythicmsythemmag
L. 22 gpanda - epicevbanrthorns
L. 22 gcamel - epiceestaffmsprout

clear cryptBOT
#
YSHINZU_倩使

You played music at a family gathering, earning zenis as tips for your talent.
Work +10 Zeni

gusty belfry
#

W fuck @foggy slate

hexed forumBOT
gusty belfry
#

Wb

hexed forumBOT
#
Nagumo goes into battle!
Player team

L. 15 :tiger2: - epicelsythrsprout
L. 15 :dog2: - epicelsythrpr
L. 15 :cat2: - rarergreatswordusafeguard

Enemy team

L. 12 :snail: - no weapon

gusty belfry
#

Wh

hexed forumBOT
#

🌱 | Nagumo, hunt is empowered by egem1[24/75] lgem3[494/800] lgem4[494/800] !
blank | You found: :bee: :beetle: :beetle: :bug: :butterfly: :butterfly: :baby_chick: :rabbit2: :cow2: :cow2: :pig2: :sheep:
blank | :tiger2: :dog2: :cat2: gained 106xp!

gusty belfry
#

Wb

hexed forumBOT
#
Nagumo goes into battle!
Player team

L. 15 :tiger2: - epicelsythrsprout
L. 15 :dog2: - epicelsythrpr
L. 15 :cat2: - rarergreatswordusafeguard

Enemy team

L. 21 gpanda - mythicmvampstaffewgen
L. 21 gshrimp - epicesstaffemanatap
L. 21 gfish - mythicmshieldeatt

gusty belfry
#

Wh

hexed forumBOT
#

🌱 | Nagumo, hunt is empowered by egem1[23/75] lgem3[488/800] lgem4[488/800] !
blank | You found: :bee: :bee: :bug: :bug: :bug: :bug: :butterfly: :butterfly: :snail: :mouse2: :rabbit2: :rooster:
blank | :tiger2: :dog2: :cat2: gained 39xp!

gusty belfry
#

Wb

hexed forumBOT
#
Nagumo goes into battle!
Player team

L. 15 :tiger2: - epicelsythrsprout
L. 15 :dog2: - epicelsythrpr
L. 15 :cat2: - rarergreatswordusafeguard

Enemy team

L. 19 :tiger2: - epiceestaffrlifesteal
L. 19 glion - epicegreatswordrkkaze
L. 19 gspider - mythicmgaxeedischarge

gusty belfry
#

Wh

hexed forumBOT
#

🌱 | Nagumo, hunt is empowered by egem1[22/75] lgem3[482/800] lgem4[482/800] !
blank | You found: :bee: :bee: :bee: :beetle: :beetle: :bug: :butterfly: :snail: :snail: :chipmunk: :rabbit2: :whale:
blank | :tiger2: :dog2: :cat2: gained 429xp!

gusty belfry
#

Wb

hexed forumBOT
#
Nagumo goes into battle!
Player team

L. 15 :tiger2: - epicelsythrsprout
L. 15 :dog2: - epicelsythrpr
L. 15 :cat2: - rarergreatswordusafeguard

Enemy team

L. 24 gfish - legendarylestafffthorns
L. 29 gspider - mythicmbowewp
L. 23 gowl - epicerstaffuwgen

gusty belfry
#

Wb

#

Wh

hexed forumBOT
#

🌱 | Nagumo, hunt is empowered by egem1[21/75] lgem3[476/800] lgem4[476/800] !
blank | You found: :bee: :bee: :bee: :bee: :butterfly: :snail: :baby_chick: :chipmunk: :rabbit2: :cow2: :pig2: :tiger2:
blank | :tiger2: :dog2: :cat2: gained 476xp!

gusty belfry
#

Wb

hexed forumBOT
#
Nagumo goes into battle!
Player team

L. 15 :tiger2: - epicelsythrsprout
L. 15 :dog2: - epicelsythrpr
L. 15 :cat2: - rarergreatswordusafeguard

Enemy team

L. 19 :tiger2: - epicepdaggermlifesteal
L. 19 gfox - mythicmvampstafflmanatap
L. 19 :snowman2: - epicehealstaffrhgen

gusty belfry
#

Wh

hexed forumBOT
#

🌱 | Nagumo, hunt is empowered by egem1[20/75] lgem3[470/800] lgem4[470/800] !
blank | You found: :bee: :beetle: :beetle: :bug: :bug: :butterfly: :snail: :chipmunk: :mouse2: :rabbit2: :rooster: :cow2:
blank | :tiger2: :dog2: :cat2: gained 67xp!

nocturne orchid
#

wh

hexed forumBOT
#

🌱 | kaz, hunt is empowered by lgem1[64/100] lgem3[382/800] lgem4[512/800] !
blank | You found: :bee: :beetle: :beetle: :beetle: :bug: :bug: :snail: :snail: :baby_chick: :baby_chick: :baby_chick: :chipmunk: :chipmunk: :mouse2: :rabbit2: :rooster:
blank | gspider gsquid gowl gained 88xp!

nocturne orchid
#

wb

hexed forumBOT
#
kaz goes into battle!
Player team

L. 33 gspider - mythicmgreatswordmhp
L. 33 gsquid - mythicmsstafflwgen
L. 33 gowl - mythicmshieldmwgen

Enemy team

L. 17 gfish - epiceshieldeabsolve
L. 17 :snowman2: - epicesytheehp
L. 17 gowl - mythicmrstafflatt

nocturne orchid
#

wah

gusty belfry
#

Wb

hexed forumBOT
#

rbot | BEEP BOOP. I AM BACK WITH 2832 ANIMALS,
blank | 40880 ESSENCE, AND 47523 EXPERIENCE
common | :beetle:³⁷³ :bug:³¹⁷ :butterfly:³⁰⁷ :bee:³³⁢ :snail:³⁴⁴
uncommon | :baby_chick:¹⁸⁸ :chipmunk:¹⁷⁷ :mouse2:¹⁡⁢ :rabbit2:¹⁢⁹ :rooster:¹⁷⁰
rare | :dog2:⁰⁡¹ :cow2:⁰⁢⁡ :cat2:⁰⁢² :pig2:⁰⁴¹ :sheep:⁰⁴⁴
epic | :elephant:⁰⁰⁡ :crocodile:⁰⁰⁡ :whale:⁰⁰⁷ :penguin:⁰⁰⁡ :tiger2:⁰⁰⁡
mythic | :dove:⁰⁰³ :dragon:⁰⁰¹ :snowman2:⁰⁰¹

#
Nagumo goes into battle!
Player team

L. 15 :tiger2: - epicelsythrsprout
L. 15 :dog2: - epicelsythrpr
L. 15 :cat2: - rarergreatswordusafeguard

Enemy team

L. 25 gshrimp - epicevampstafflabsolve
L. 25 gpanda - epicesstaffemag
L. 25 dwolf - mythicmshieldeatt

nocturne orchid
#

wsac all

hexed forumBOT
#

πŸ”ͺ | kaz sacrificed uncommonx884 commonx1724 rarex269 epicx28 mythicx5 gemx1 legendaryx1 for a total of essence 63,524

gusty belfry
#

Wah

hexed forumBOT
#
Nagumo's HuntBot
`BEEP. BOOP. I AM HUNTBOT. I WILL HUNT FOR YOU MASTER.`

Use the command owo autohunt {cowoncy} to get started.
You can use owo upgrade {trait} {count} to upgrade the traits below.
To obtain more essence, use owo sacrifice {animal} {count}.

⏱ Efficiency - `25/H`

Lvl 0 [0/10]
[β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘]

⏳ Duration - `0.5H`

Lvl 0 [0/10]
[β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘]

<:cowoncy:416043450337853441> Cost - `10 cowoncy`

Lvl 0 [0/1000]
[β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘]

πŸ”§ Gain - `0 essence/H`

Lvl 0 [0/10]
[β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘]

βš” Experience - `0 xp/H`

Lvl 0 [0/10]
[β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘]

πŸ“‘ Radar - `0 %`

Lvl 0 [0/50]
[β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘]

<a:essence:451638978299428875> Animal Essence - `2,898`

Current Max Autohunt: 12 animals, 0 essence, and 0 xp for 120 cowoncy

gusty belfry
#

wsac all

hexed forumBOT
#

πŸ”ͺ | Nagumo sacrificed uncommonx169 commonx391 rarex69 epicx5 gemx2 for a total of essence 43,866

gusty belfry
#

Wb

hexed forumBOT
#
Nagumo goes into battle!
Player team

L. 15 :tiger2: - epicelsythrsprout
L. 15 :dog2: - epicelsythrpr
L. 15 :cat2: - rarergreatswordusafeguard

Enemy team

L. 18 gowl - no weapon
L. 18 :whale: - no weapon
L. 18 :crocodile: - no weapon

gusty belfry
#

Wh

hexed forumBOT
#

🌱 | Nagumo, hunt is empowered by egem1[19/75] lgem3[464/800] lgem4[464/800] !
blank | You found: :bee: :bee: :beetle: :beetle: :beetle: :bug: :butterfly: :snail: :chipmunk: :mouse2: :rabbit2: :pig2:
blank | :tiger2: :dog2: :cat2: gained 58xp!

gusty belfry
#

Wh

#

Wb

hexed forumBOT
#
Nagumo goes into battle!
Player team

L. 15 :tiger2: - epicelsythrsprout
L. 15 :dog2: - epicelsythrpr
L. 15 :cat2: - rarergreatswordusafeguard

Enemy team

L. 17 :snail: - rarervampstaffmdischarge
L. 17 :cat2: - epicegreatswordepr
L. 17 :cow2: - rarergaxeedischarge

gusty belfry
#

Wh

hexed forumBOT
#

🌱 | Nagumo, hunt is empowered by egem1[18/75] lgem3[458/800] lgem4[458/800] !
blank | You found: :bee: :bee: :beetle: :bug: :bug: :snail: :mouse2: :rabbit2: :rabbit2: :cow2: :crocodile: :whale:
blank | :tiger2: :dog2: :cat2: gained 856xp!

gusty belfry
#

Wxp

hexed forumBOT
#

πŸŽ‰ | YSHINZU_倩使 leveled up!

#

blank | YSHINZU_倩使 opens 21 lootboxes
boxopen | and finds: cgem1Β² ugem1ΒΉ rgem1Β³ egem1ΒΉ cgem3ΒΉ rgem3ΒΉ egem3Β² lgem3Β² cgem4Β² ugem4Β³ rgem4Β² mgem4ΒΉ

#

blank | YSHINZU_倩使 opens 20 weapon crates
crateopen | and finds: eawanderstaffprorbprsstaffrvampstaffrpdaggerprlsythprlsythrgreatswordrfstaffrasceptrshieldrgaxerawandrpstaffusstaffupdaggeruffishupdaggercbow

#

🌱 | YSHINZU_倩使, hunt is empowered by mgem1[60/75] !
blank | You found: :bee: :bee: :bug: :butterfly: :baby_chick: :mouse2: :rooster:
blank | gdeer gowl gspider gained 34xp!

#
YSHINZU_倩使 goes into battle!
Player team

L. 20 gdeer - mythicmestaffmsprout
L. 20 gowl - mythicpmestaffmlifesteal
L. 20 gspider - mythicmorbmmanatapmdischarge

Enemy team

L. 17 :unicorn: - rarerhealstaffesprout
L. 17 gpanda - mythicmshieldmmr
L. 17 gowl - epicesstaffmabsolve

#

cowoncy | YSHINZU_倩使, you currently have 159,790 cowoncy!

gusty belfry
#

W pray @foggy slate

hexed forumBOT
#

πŸ™ | @gusty belfry prays for @foggy slate! Luck is on your side!
blank | You have 55 luck point(s)!

#

πŸ“œ | yshinzu_70! You finished a quest and earned: boxboxboxboxboxbox!

gusty belfry
#

Wb

hexed forumBOT
#
Nagumo goes into battle!
Player team

L. 15 :tiger2: - epicelsythrsprout
L. 15 :dog2: - epicelsythrpr
L. 15 :cat2: - rarergreatswordusafeguard

Enemy team

L. 19 gfox - mythicmgreatswordesafeguard
L. 19 gowl - mythicmvampstaffmpr
L. 19 500kdino - mythicmrstaffmcritical

gusty belfry
#

Wh

hexed forumBOT
#

🌱 | Nagumo, hunt is empowered by egem1[17/75] lgem3[452/800] lgem4[452/800] !
blank | You found: :bee: :bee: :bee: :bug: :butterfly: :butterfly: :snail: :chipmunk: :mouse2: :mouse2: :mouse2: :rabbit2:
blank | :tiger2: :dog2: :cat2: gained 57xp!

#

blank | YSHINZU_倩使 opens 6 lootboxes
boxopen | and finds: cgem1ΒΉ ugem1ΒΉ cgem4ΒΉ ugem4ΒΉ rgem4Β²

#
YSHINZU_倩使's Quest Log

These quests belong to @foggy slate
1. Manually hunt 1000 times!blankβ€£ Reward: 50,000 cowoncy
blankβ€£ Progress: [375/1000]

gusty belfry
#

Wb

hexed forumBOT
#
Nagumo goes into battle!
Player team

L. 15 :tiger2: - epicelsythrsprout
L. 15 :dog2: - epicelsythrpr
L. 15 :cat2: - rarergreatswordusafeguard

Enemy team

L. 19 :snowman2: - epiceestaffrhp
L. 19 :elephant: - rarerhealstaffeatt
L. 19 gfish - mythicmorblattmatt

molten glen
#

My!work

clear cryptBOT
#
glass.spells

You wrote a short story and submitted it to a contest, winning a zeni for your creativity.
Work +10 Zeni
<@&580565140420821013> +10 Zeni

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by lgem1[15/100] lgem3[568/800] lgem4[232/800] !
blank | You found: :beetle: :beetle: :beetle: :beetle: :beetle: :bug: :butterfly: :snail: :baby_chick: :rabbit2: :rooster: :rooster: :rooster: :cat2: :dog2: :sheep:
blank | 2025feb_laki dboar 2025feb_jose gained 118xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 25 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 17 :butterfly: - no weapon
L. 17 :rooster: - no weapon
L. 17 :rabbit2: - no weapon

molten glen
#

My!work

clear cryptBOT
#
glass.spells

You painted your friend’s nails and they gave you a zeni as a tip.
Work +10 Zeni
<@&580565140420821013> +10 Zeni

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by lgem1[14/100] lgem3[560/800] lgem4[224/800] !
blank | You found: :bee: :beetle: :beetle: :beetle: :snail: :snail: :baby_chick: :mouse2: :rabbit2: :rabbit2: :rabbit2: :rooster: :rooster: :dog2: :pig2: :pig2:
blank | 2025feb_laki dboar 2025feb_jose gained 136xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 25 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 11 :snail: - no weapon

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by lgem1[13/100] lgem3[552/800] lgem4[216/800] !
blank | You found: :bee: :bee: :bee: :bug: :bug: :butterfly: :butterfly: :butterfly: :butterfly: :snail: :snail: :baby_chick: :chipmunk: :rabbit2: :rabbit2: :pig2:
blank | 2025feb_laki dboar 2025feb_jose gained 71xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 25 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 16 :whale: - legendarylorblabsolvelthorns
L. 16 :cow2: - mythicmrstaffmpr
L. 16 :dog2: - mythicmshieldmhgen

molten glen
#

My!work

clear cryptBOT
#
glass.spells

You read a quote: "When looking at stars, you're actually looking into the past. How fascinating, the beauty of living."
Work +10 Zeni
<@&580565140420821013> +10 Zeni

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by lgem1[12/100] lgem3[544/800] lgem4[208/800] !
blank | You found: :bee: :bee: :beetle: :beetle: :beetle: :beetle: :butterfly: :butterfly: :butterfly: :snail: :baby_chick: :chipmunk: :chipmunk: :mouse2: :rabbit2: :rooster:
blank | 2025feb_laki dboar 2025feb_jose gained 70xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 25 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 14 :snail: - no weapon
L. 14 :pig2: - no weapon
L. 14 :cat2: - no weapon

molten glen
#

My!work

clear cryptBOT
#
glass.spells

You read a quote: "I didn't fail the test. I just found 100 ways to do it wrong."
Work +10 Zeni
<@&580565140420821013> +10 Zeni

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by lgem1[11/100] lgem3[536/800] lgem4[200/800] !
blank | You found: :bee: :bee: :bee: :beetle: :beetle: :bug: :bug: :butterfly: :snail: :snail: :chipmunk: :chipmunk: :mouse2: :mouse2: :rooster: :rooster:
blank | 2025feb_laki dboar 2025feb_jose gained 70xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 25 2025feb_jose - mythicmshieldmwgen

omg

L. 20 2023pride_bat - mythicmorbethornslthorns
L. 20 2023easter_Alvin - mythicmboweatt
L. 20 2023bday_owo - mythicmestaffmsafeguard

molten glen
#

My!work

clear cryptBOT
#
glass.spells

You won a race on the Redline circuit in *Redline*, receiving a zenis prize for first place.
Work +10 Zeni
<@&580565140420821013> +10 Zeni

molten glen
#

My!work

clear cryptBOT
#
glass.spells

You read a quote: "When looking at stars, you're actually looking into the past. How fascinating, the beauty of living."
Work +10 Zeni
<@&580565140420821013> +10 Zeni

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by lgem1[10/100] lgem3[528/800] lgem4[192/800] !
blank | You found: :bee: :bee: :beetle: :beetle: :beetle: :beetle: :beetle: :bug: :bug: :butterfly: :butterfly: :snail: :baby_chick: :mouse2: :rooster: :rooster:
blank | 2025feb_laki dboar 2025feb_jose gained 52xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 25 2025feb_jose - mythicmshieldmwgen

:emoji_47:

L. 18 gshrimp - mythicmgreatswordmsprout
L. 18 :unicorn: - mythicmbowmmanatap
L. 18 gfox - mythicmasceptemr

molten glen
#

Wpray

hexed forumBOT
#

πŸ™ | @molten glen prays... You can feel the luck within you!
blank | You have 484 luck point(s)!

molten glen
#

Wrun

hexed forumBOT
#

🚫 | You are too tired to run!
blank | You ran 9 kilometer(s) today!
blank | You can run 10 kilometers tomorrow!
blank | You ran 694 in total!

molten glen
#

Wpup

hexed forumBOT
#

puppy | You picked up one puppy!!
blank | You adopted 11/12 puppies today!
blank | You adopted 829 puppies in total!

molten glen
#

Wpiku

hexed forumBOT
#

πŸ₯• | You picked one PikPik carrot!
blank | You harvested 11/12 today!
blank | You have 821 carrots in total!

molten glen
#

Warmy

hexed forumBOT
#

rusty | Scavenging through the messages, you found the rusty ol' Rusty Army Emblem!
blank | Today's remaining Broken Army Emblem : 4

molten glen
#

Owo

molten glen
#

My!work

clear cryptBOT
#
glass.spells

You serve the Immortals in Animazing.
Work +10 Zeni
<@&580565140420821013> +10 Zeni

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by lgem1[9/100] lgem3[520/800] lgem4[184/800] !
blank | You found: :bee: :bee: :beetle: :beetle: :beetle: :bug: :snail: :snail: :snail: :baby_chick: :chipmunk: :mouse2: :mouse2: :cat2: :cat2: :sheep:
blank | 2025feb_laki dboar 2025feb_jose gained 109xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 25 2025feb_jose - mythicmshieldmwgen

:What:

L. 30 gfish - epiceestaffudischarge
L. 30 2021july4 - legendarylhealstafflsafeguard
L. 30 gspider - mythicmboweabsolve

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by lgem1[8/100] lgem3[512/800] lgem4[176/800] !
blank | You found: :bee: :bee: :bee: :beetle: :beetle: :bug: :bug: :butterfly: :snail: :snail: :baby_chick: :rabbit2: :rooster: :dog2: :pig2: :tiger2:
blank | 2025feb_laki dboar 2025feb_jose gained 480xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 25 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 16 :dog2: - no weapon
L. 16 :pig2: - no weapon
L. 16 :sheep: - no weapon

ancient sundial
#

kbi

cobalt jettyBOT
# ancient sundial kbi
Bits

Bits carried by @ancient sundial

β—Ύ 1,528 Β· salt bit Β· Salt Bit
β—Ύ 1,412 Β· stone bit Β· Stone Bit
β—Ύ 1,392 Β· leaf bit Β· Leaf Bit
β—Ύ 1,310 Β· wax bit Β· Wax Bit
β—Ύ 1,299 Β· wood bit Β· Wood Bit
β—Ύ 387 Β· iron bit Β· Iron Bit
β—Ύ 248 Β· bone bit Β· Bone Bit
β—Ύ 237 Β· ice bit Β· Ice Bit
β—Ύ 231 Β· oil bit Β· Oil Bit
β—Ύ 213 Β· essence bit Β· Essence Bit

ancient sundial
#

kc c:ban

cobalt jettyBOT
# ancient sundial kc c:ban
Card Collection

Cards owned by @ancient sundial

πŸ‰ Β z1zx5x Β· β˜†β˜†β˜†β˜† Β· #22378 Β· β—ˆ1 Β· Dragon Ball Β· Bandages the Mummy
πŸ₯Ά v44b9xj Β· β˜…β˜…β˜…β˜… Β· #71724 Β· β—ˆ1 Β· Mobile Suit Gundam Unicorn Β· Banshee
πŸ”’ Β 3s2q25 Β· β˜…β˜…β˜…β˜… Β· #4667Β  Β· β—ˆ3 Β· The Seven Deadly Sins Β· Ban

ancient sundial
#

kmorph 3s2q25 salt

cobalt jettyBOT
# ancient sundial kmorph 3s2q25 salt
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Salt Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Salt Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Salt Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Salt Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Salt Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Salt Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Salt Bits by using the 🎲 button.

You do not have enough bits.

ancient sundial
#

kbi

cobalt jettyBOT
# ancient sundial kbi
Bits

Bits carried by @ancient sundial

β—Ύ 1,412 Β· stone bit Β· Stone Bit
β—Ύ 1,392 Β· leaf bit Β· Leaf Bit
β—Ύ 1,310 Β· wax bit Β· Wax Bit
β—Ύ 1,299 Β· wood bit Β· Wood Bit
β—Ύ 387 Β· iron bit Β· Iron Bit
β—Ύ 248 Β· bone bit Β· Bone Bit
β—Ύ 237 Β· ice bit Β· Ice Bit
β—Ύ 231 Β· oil bit Β· Oil Bit
β—Ύ 213 Β· essence bit Β· Essence Bit
β—Ύ 163 Β· wool bit Β· Wool Bit

ancient sundial
#

kmorph 3s2q25 stone

cobalt jettyBOT
# ancient sundial kmorph 3s2q25 stone
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Stone Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Stone Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Stone Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Stone Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Stone Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Stone Bits by using the 🎲 button.

You do not have enough bits.

ancient sundial
#

kmorph 3s2q25 leaf

cobalt jettyBOT
# ancient sundial kmorph 3s2q25 leaf
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Leaf Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Leaf Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Leaf Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Leaf Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Leaf Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Leaf Bits by using the 🎲 button.

You do not have enough bits.

ancient sundial
#

kb

cobalt jettyBOT
# ancient sundial kb
Burn Card

@ancient sundial, you will receive:

πŸ’° 1 Gold
✨ 1 Dust (β˜†β˜†β˜†β˜†)

Card burning has been canceled.

ancient sundial
#

kbi

cobalt jettyBOT
# ancient sundial kbi
Bits

Bits carried by @ancient sundial

β—Ύ 1,310 Β· wax bit Β· Wax Bit
β—Ύ 1,299 Β· wood bit Β· Wood Bit
β—Ύ 387 Β· iron bit Β· Iron Bit
β—Ύ 248 Β· bone bit Β· Bone Bit
β—Ύ 237 Β· ice bit Β· Ice Bit
β—Ύ 231 Β· oil bit Β· Oil Bit
β—Ύ 213 Β· essence bit Β· Essence Bit
β—Ύ 163 Β· wool bit Β· Wool Bit
β—Ύ 162 Β· stone bit Β· Stone Bit
β—Ύ 142 Β· leaf bit Β· Leaf Bit

ancient sundial
#

kmorph 3s2q25 wax

cobalt jettyBOT
# ancient sundial kmorph 3s2q25 wax
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Wax Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Wax Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Wax Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Wax Bits by using the 🎲 button.

The card has been morphed.

violet tangle
#

Oo

ancient sundial
#

still close to red

#

kbi

cobalt jettyBOT
# ancient sundial kbi
Bits

Bits carried by @ancient sundial

β—Ύ 1,299 Β· wood bit Β· Wood Bit
β—Ύ 560 Β· wax bit Β· Wax Bit
β—Ύ 387 Β· iron bit Β· Iron Bit
β—Ύ 248 Β· bone bit Β· Bone Bit
β—Ύ 237 Β· ice bit Β· Ice Bit
β—Ύ 231 Β· oil bit Β· Oil Bit
β—Ύ 213 Β· essence bit Β· Essence Bit
β—Ύ 163 Β· wool bit Β· Wool Bit
β—Ύ 162 Β· stone bit Β· Stone Bit
β—Ύ 142 Β· leaf bit Β· Leaf Bit

ancient sundial
#

kmorph 3s2q25 wax

cobalt jettyBOT
#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Wax Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Wax Bits by using the 🎲 button.

ancient sundial
#

kmorph 3s2q25 wood

cobalt jettyBOT
# ancient sundial kmorph 3s2q25 wood
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Wood Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Wood Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Wood Bits by using the 🎲 button.

ancient sundial
#

tf are those colors

#

@violet tangle

violet tangle
#

Uhmm

ancient sundial
#

exotic ahh

cobalt jettyBOT
#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Wood Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Wood Bits by using the 🎲 button.

#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Wood Bits by using the 🎲 button.

You do not have enough bits.

ancient sundial
#

rip

violet tangle
#

Dude

#

Wait

ancient sundial
violet tangle
#

@honest lintel is that black?

ancient sundial
#

the frame is already black stock

violet tangle
#

Idk man AA_Cat_Stare maybe hold onto it until nxsen says if it’s black or not. Black morphs are worth something I believe

ancient sundial
#

kfs

cobalt jettyBOT
ancient sundial
#

its already dark

violet tangle
ancient sundial
#

kbi

cobalt jettyBOT
# ancient sundial kbi
Bits

Bits carried by @ancient sundial

β—Ύ 387 Β· iron bit Β· Iron Bit
β—Ύ 248 Β· bone bit Β· Bone Bit
β—Ύ 237 Β· ice bit Β· Ice Bit
β—Ύ 231 Β· oil bit Β· Oil Bit
β—Ύ 213 Β· essence bit Β· Essence Bit
β—Ύ 163 Β· wool bit Β· Wool Bit
β—Ύ 162 Β· stone bit Β· Stone Bit
β—Ύ 142 Β· leaf bit Β· Leaf Bit
β—Ύ 137 Β· clay bit Β· Clay Bit
β—Ύ 132 Β· quartz bit Β· Quartz Bit

ancient sundial
#

kmorph 3s2q25 iron

cobalt jettyBOT
# ancient sundial kmorph 3s2q25 iron
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Iron Bits by using the 🎲 button.

ancient sundial
#

look

violet tangle
#

No it’s just still there because it’s the last one you left on

cobalt jettyBOT
#
Morph Card

@ancient sundial, you are morphing 3s2q25.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Iron Bits by using the 🎲 button.

ancient sundial
#

still gives a lot

violet tangle
#

Then maybe it isn’t AA_Keqing_Think

#

Oh well

ancient sundial
#

ion knwo

#

krm

cobalt jettyBOT
# ancient sundial krm
Reminders

πŸ”• Daily in 22 hours
πŸ”• Vote in 1 hour
πŸ”• Drop is ready
πŸ”• Grab is ready
πŸ”• Work in 9 hours
πŸ”• Visit is ready

ancient sundial
#

kd

cobalt jettyBOT
runic kernel
#

owodaily

hexed forumBOT
#

πŸ’° | liyza, Here is your daily cowoncy 5000 Cowoncy!
blank | You're on a 418 daily streak!
crate | You received a weapon crate!
⏱️ | Your next daily is in: 9H 54M 3S

runic kernel
#

owoslap @molten glen

waxen walrus
#

my!balance

clear cryptBOT
#
josephjoestar._'s Balance!
molten glen
#

My!work

clear cryptBOT
#
glass.spells

You crafted a magical charm, and a sorceress bought it from you.
Work +10 Zeni
<@&580565140420821013> +10 Zeni

molten glen
#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by lgem1[7/100] lgem3[504/800] lgem4[168/800] !
blank | You found: :bee: :beetle: :beetle: :butterfly: :butterfly: :snail: :snail: :snail: :snail: :rabbit2: :rabbit2: :rabbit2: :rooster: :cat2: :dog2: :sheep:
blank | 2025feb_laki dboar 2025feb_jose gained 109xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 25 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 12 :rooster: - uncommonupdaggeruatt
L. 2 :cow2: - uncommonpuestaffehgen
L. 12 :bug: - rarerorbrwprdischarge

runic kernel
rigid copper
#

wh

hexed forumBOT
#

🌱 | ERYNTH, hunt is empowered by lgem1[4/100] lgem3[32/800] lgem4[32/800] !
blank | You found: :bee: :bee: :bee: :bee: :beetle: :beetle: :beetle: :bug: :bug: :bug: :snail: :snail: :baby_chick: :baby_chick: :pig2: :pig2:
blank | 2022hal_mummy 2022hal_catrina 2022hal_Zowombie gained 72xp!
box | You found a lootbox! [1/3] RESETS IN: 9H 45M 51S

rigid copper
#

wdaily

hexed forumBOT
#

πŸ’° | ERYNTH, Here is your daily cowoncy 1080 Cowoncy!
blank | You're on a 20 daily streak!
box | You received a lootbox!
⏱️ | Your next daily is in: 9H 45M 49S

rigid copper
#

wb

hexed forumBOT
#

crate | ERYNTH, You found a weapon crate! [1/3] RESETS IN: 9H 45M 47S

#
ERYNTH goes into battle!
<a:winetime:1047474609806643262>

L. 24 2022hal_mummy - legendarylgreatswordlthorns
L. 24 2022hal_catrina - legendarylshieldmlifesteal
L. 24 2022hal_Zowombie - legendarylbowlpr

Enemy team

L. 22 2024feb_fastelavn - mythicmshieldmmanatap
L. 24 2023christmas_owo - mythicmpstaffmkkaze
L. 22 2024feb_valentines - mythicmpdaggerlmag

rigid copper
#

eq

#

w

#

wq

hexed forumBOT
#
ERYNTH's Quest Log

These quests belong to @rigid copper
1. Have a friend pray to you 5 times!blankβ€£ Reward: 400 weaponshard
blankβ€£ Progress: [3/5]
2. Have a friend curse you 15 times!blankβ€£ Reward: boxboxboxboxboxbox
blankβ€£ Progress: [1/15]
3. Gamble 5 times!blankβ€£ Reward: box
blankβ€£ Progress: [0/5]

rigid copper
#

wslots 50000

hexed forumBOT
#

** ___SLOTS___**
cherry cherry cherry ERYNTH bet cowoncy 50,000
| | and won cowoncy 150,000
| |

rigid copper
#

wbj 10000

hexed forumBOT
#
erynn.13, you bet 10,000 to play blackjack
Dealer `[17]`

qs 7cf

erynn.13 `[19]`

jc 9s

rigid copper
#

wbj 10000

#

wslots 20000

hexed forumBOT
#

** ___SLOTS___**
cherry cherry cherry ERYNTH bet cowoncy 20,000
| | and won cowoncy 60,000
| |

rigid copper
#

wbj 10000

hexed forumBOT
#
erynn.13, you bet 10,000 to play blackjack
Dealer `[22]`

8s 2sf 3cf 9sf

erynn.13 `[20]`

qc 2h 8h

rigid copper
#

wslots 30000

hexed forumBOT
#

** ___SLOTS___**
cowoncy cherry cowoncy ERYNTH bet cowoncy 30,000
| | and won nothing... :c
| |

#

πŸ“œ | ERYNTH! You finished a quest and earned: box!

ruby sedge
#

Wpray

hexed forumBOT
#

πŸ™ | @ruby sedge prays... Luck is on your side!
blank | You have 254 luck point(s)!

ruby sedge
#

T!cookie @molten glen

heavy pewterBOT
#
Cookie given!

suite69 has given @molten glen a cookie!

πŸ“₯ 8 | πŸ“€ 5

molten glen
#

Wpray @rigid copper

hexed forumBOT
#

πŸ™ | @molten glen prays for @rigid copper! May luck be in your favor.
blank | You have 483 luck point(s)!

molten glen
#

T!cookie @ruby sedge

heavy pewterBOT
#
Cookie given!

glass.spells has given @ruby sedge a cookie!

πŸ“₯ 325 | πŸ“€ 88

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by lgem1[6/100] lgem3[496/800] lgem4[160/800] !
blank | You found: :bee: :bee: :bee: :bee: :beetle: :beetle: :bug: :bug: :snail: :snail: :baby_chick: :baby_chick: :chipmunk: :chipmunk: :rooster: :pig2:
blank | 2025feb_laki dboar 2025feb_jose gained 80xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 25 2025feb_jose - mythicmshieldmwgen

The Almighty Sayangku

L. 22 2024spring_patrick - rarerestaffrmanatap
L. 22 2024feb_owo - epicesstaffmwgen
L. 22 2024july_owo - epicpeshieldewp

molten glen
#

My!work

clear cryptBOT
#
glass.spells

You started a garden and sold the vegetables, earning zenis at the farmer’s market.
Work +10 Zeni
<@&580565140420821013> +10 Zeni

ruby sedge
#

Wpray @stable snow

hexed forumBOT
#

πŸ™ | @ruby sedge prays for @stable snow! You can feel the luck within you!
blank | You have 253 luck point(s)!

molten glen
#

My!work

clear cryptBOT
#
glass.spells

You piloted a Gundam in *Mobile Suit Gundam*, receiving zenis for a successful mission.
Work +10 Zeni
<@&580565140420821013> +10 Zeni

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by lgem1[5/100] lgem3[488/800] lgem4[152/800] !
blank | You found: :bee: :bee: :beetle: :beetle: :beetle: :bug: :butterfly: :butterfly: :snail: :snail: :baby_chick: :baby_chick: :chipmunk: :rabbit2: :rooster: :cat2:
blank | 2025feb_laki dboar 2025feb_jose gained 80xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 25 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 23 :bug: - no weapon
L. 23 :snail: - no weapon

molten glen
#

Wpray @rigid copper

hexed forumBOT
#

πŸ™ | @molten glen prays for @rigid copper! You can feel the luck within you!
blank | You have 482 luck point(s)!

#

πŸ“œ | erynn.13! You finished a quest and earned: weaponshardx400!

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by lgem1[4/100] lgem3[480/800] lgem4[144/800] !
blank | You found: :bee: :beetle: :beetle: :bug: :butterfly: :butterfly: :snail: :snail: :snail: :baby_chick: :mouse2: :mouse2: :rabbit2: :cow2: :dog2: :dog2:
blank | 2025feb_laki dboar 2025feb_jose gained 109xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 25 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 20 :bug: - no weapon
L. 20 :beetle: - no weapon

molten glen
#

Owo

#

W s 5000

hexed forumBOT
#

** ___SLOTS___**
eggplant eggplant eggplant π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ bet cowoncy 5,000
| | and won cowoncy 5,000
| |

molten glen
#

W bj 5000

hexed forumBOT
#
glass.spells, you bet 5,000 to play blackjack
Dealer `[19]`

7s 2df kcf

glass.spells `[18]`

js 3c 5h

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by lgem1[3/100] lgem3[472/800] lgem4[136/800] !
blank | You found: :bee: :beetle: :bug: :snail: :baby_chick: :chipmunk: :chipmunk: :chipmunk: :rabbit2: :rooster: :cow2: :pig2: :pig2: :pig2: :sheep: gsquid
blank | 2025feb_laki dboar 2025feb_jose gained 2164xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 25 2025feb_jose - mythicmshieldmwgen

~Perahu Kertas~

L. 17 2023val_DevilOwO - no weapon
L. 17 :snail: - no weapon
L. 17 :tiger2: - no weapon

molten glen
#

Wchecklist

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡'s Checklist

β˜‘οΈ 🎁 You have claimed your daily!
β˜‘οΈ πŸ“ You can claim your vote in 5 hours!
β˜‘οΈ πŸͺ You have used your cookie!
β˜‘οΈ πŸ“œ You already claimed today's quest! (+rr)
β˜‘οΈ πŸ’Ž You have found all lootboxes!
β˜‘οΈ βš” You have found all weapon crates!
β˜‘οΈ πŸŽ‰ You already claimed your checklist rewards!

molten glen
#

Wq

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡'s Quest Log

These quests belong to @molten glen
UwU You finished all of your quests! Come back tomorrow! <3

molten glen
#

Owo

#

Wpup

hexed forumBOT
#

puppy | You picked up one puppy!!
blank | You adopted 12/12 puppies today!
blank | You adopted 830 puppies in total!

molten glen
#

Wpiku

hexed forumBOT
#

πŸ₯• | You picked one PikPik carrot!
blank | You harvested 12/12 today!
blank | You have 822 carrots in total!

molten glen
#

Warmy

hexed forumBOT
#

rusty | Scavenging through the messages, you found the rusty ol' Rusty Army Emblem!
blank | Today's remaining Broken Army Emblem : 3

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by lgem1[2/100] lgem3[464/800] lgem4[128/800] !
blank | You found: :bee: :bug: :bug: :bug: :bug: :bug: :butterfly: :butterfly: :baby_chick: :baby_chick: :chipmunk: :rabbit2: :rabbit2: :pig2: :pig2: :sheep:
blank | 2025feb_laki dboar 2025feb_jose gained 118xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 25 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 14 :pig2: - no weapon

molten glen
#

Wdance

molten glen
#

Whug @tidal merlin

molten glen
#

My!cd

clear cryptBOT
#
glass.spells's Cooldowns
Daily Command

3h, 5m, 1s

Heart Command

5h, 1m, 41s

Work Command

1m, 3s

molten glen
#

Wpat @primal swallow

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by lgem1[1/100] lgem3[456/800] lgem4[120/800] !
blank | You found: :beetle: :bug: :bug: :bug: :butterfly: :butterfly: :butterfly: :butterfly: :snail: :baby_chick: :rabbit2: :cat2: :dog2: :pig2: :sheep: :sheep:
blank | 2025feb_laki dboar 2025feb_jose gained 129xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 25 2025feb_jose - mythicmshieldmwgen

bruhsquad

L. 22 gshrimp - rarergreatswordlatt
L. 22 gpanda - epiceorbemanatapekkaze
L. 22 gfish - no weapon

molten glen
#

Wbite @fast glacier

tidal merlin
#

owo hug @molten glen

#

hi

tidal merlin
#

Owoh

#

owob

hexed forumBOT
#

🌱 | Syphax (Drazoth), hunt is empowered by lgem1[21/100] lgem3[552/800] lgem4[168/800] !
blank | You found: :beetle: :beetle: :bug: :bug: :bug: :bug: :butterfly: :butterfly: :snail: :snail: :mouse2: :mouse2: :mouse2: :mouse2: :dog2: pdolphin
blank | GigaChad dgorilla gcamel gained 470xp!
box | You found a lootbox! [2/3] RESETS IN: 9H 3M 3S

#
Syphax (Drazoth) goes into battle!
Player team

L. 26 GigaChad - epicerstaffrsnail
L. 18 dgorilla - mythicmshieldepr
L. 26 gcamel - mythicmhealstaffmsnail

Enemy team

L. 18 :whale: - epiceorbumagmsafeguard
L. 18 :dog2: - epicehealstaffedischarge
L. 18 :cow2: - epiceestaffesac

molten glen
#

Hi hi draz

tidal merlin
#

owo pray @molten glen

molten glen
#

Wgrin

hexed forumBOT
#

πŸ™ | @tidal merlin prays for @molten glen! You can feel the luck within you!
blank | You have -372 luck point(s)!

molten glen
#

T!cookie @tidal merlin

heavy pewterBOT
#
Cookie given!

glass.spells has given @tidal merlin a cookie!

πŸ“₯ 325 | πŸ“€ 89

molten glen
#

929

#

Owo

#

Wh

tidal merlin
#

T!cookie @molten glen

molten glen
#

Wb

heavy pewterBOT
#
Cookie given!

syphax115 has given @molten glen a cookie!

πŸ“₯ 11 | πŸ“€ 5

tidal merlin
#

Oowh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by lgem1[0/100] lgem3[448/800] lgem4[112/800] !
blank | You found: :bee: :bee: :bee: :bee: :beetle: :snail: :snail: :snail: :snail: :baby_chick: :chipmunk: :chipmunk: :rabbit2: :rooster: :cat2: :pig2:
blank | 2025feb_laki dboar 2025feb_jose gained 99xp!

tidal merlin
#

owob

#

owooh

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 25 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 16 :whale: - no weapon
L. 16 :butterfly: - no weapon

tidal merlin
#

owo z d

molten glen
#

Winv

hexed forumBOT
#
Syphax (Drazoth) goes into battle!
Player team

L. 26 GigaChad - epicerstaffrsnail
L. 18 dgorilla - mythicmshieldepr
L. 26 gcamel - mythicmhealstaffmsnail

Enemy team

L. 17 :dog2: - epiceasceptrthorns
L. 17 :tiger2: - epicegaxemhp
L. 17 :cat2: - epiceasceptmwp

#

🌿 🌱 🌳** Syphax (Drazoth)'s zoo! **🌳 🌿 🌱
common :bee:¹⁸⁴⁹⁹ :bug:¹⁸⁢¹⁸ :snail:¹⁸⁡³⁸ :beetle:¹⁸⁡⁢⁸ :butterfly:¹⁸⁸⁹³
uncommon :baby_chick:⁰⁹⁡³² :mouse2:⁰⁹⁴⁹⁰ :rooster:⁰⁹³⁢⁸ :rabbit2:⁰⁹⁡⁷⁷ :chipmunk:⁰⁹⁴⁸⁡
rare :sheep:⁰³¹⁴⁰ :pig2:⁰³¹⁸² :cow2:⁰³¹⁷⁴ :dog2:⁰³¹⁴⁷ :cat2:⁰³¹⁸⁰
epic :crocodile:⁰⁰³³³ :tiger2:⁰⁰³²¹ :penguin:⁰⁰³¹⁹ :elephant:⁰⁰³³⁡ :whale:⁰⁰³⁰⁰
patreon pbird⁰⁰⁰⁸⁢ pdolphin⁰⁰⁰⁢⁴ pogre⁰⁰⁰⁴⁸ pscorpion⁰⁰⁰⁢⁹ ptiger⁰⁰⁰⁡⁷
special 2025feb_laki⁰⁰⁰⁰²
mythic :dragon:⁰⁰⁰³⁹ :unicorn:⁰⁰⁰³¹ :snowman2:⁰⁰⁰³⁢ :ghost:⁰⁰⁰⁴¹ :dove:⁰⁰⁰²⁸
gem gcamel⁰⁰⁰⁰³ gfish⁰⁰⁰⁰¹ gpanda⁰⁰⁰⁰⁡ gshrimp⁰⁰⁰⁰¹ gspider⁰⁰⁰⁰³
legendary gdeer⁰⁰⁰²³ gfox⁰⁰⁰¹⁸ glion⁰⁰⁰¹⁴ gowl⁰⁰⁰²¹ gsquid⁰⁰⁰¹⁴
cpatreon GigaChad⁰⁰⁰⁰¹ purrito⁰⁰⁰⁰¹ Yan3⁰⁰⁰⁰¹
fabled dgorilla⁰⁰⁰⁰¹
Zoo Points: 3,071,836
F-1, CP-3, G-13, L-90, P-324, M-175, S-2, E-1608, R-15823, U-47452, C-93116

#

====== π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡'s Inventory ======
050box¹⁴ 051cgem1⁴² 052ugem1²⁡ 053rgem1¹³
054egem1¹⁹ 065cgem3³⁴ 066ugem3²⁢ 067rgem3⁰⁷
068egem3²⁰ 072cgem4³⁷ 073ugem4¹⁢ 074rgem4¹⁹
077lgem4⁰¹ 085fstar⁰² 100crate³⁷ 101greatsword⁰¹
102healstaff⁰¹ 103bow⁰¹ 105shield⁰³ 106orb⁰⁴
110fstaff⁰¹ 111estaff⁰¹ 112sstaff⁰¹ 114rstaff⁰¹
117sythe⁰¹ 119pstaff⁰¹ 120lsyth⁰³ 2--πŸ–Όβ°ΒΉ

tidal merlin
#

owoh

hexed forumBOT
#

🌱 | Syphax (Drazoth), hunt is empowered by lgem1[20/100] lgem3[544/800] lgem4[160/800] !
blank | You found: :bug: :butterfly: :butterfly: :butterfly: :butterfly: :butterfly: :snail: :snail: :snail: :chipmunk: :mouse2: :mouse2: :mouse2: :rooster: :dog2: :pig2:
blank | GigaChad dgorilla gcamel gained 99xp!

molten glen
#

Owo use 54

hexed forumBOT
#

egem1 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, you activated a(n) Epic Hunting Gem!
blank | Your next 75 manual hunts will be increased by 5

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by egem1[74/75] lgem3[442/800] lgem4[106/800] !
blank | You found: :bee: :bee: :butterfly: :butterfly: :snail: :snail: :snail: :snail: :baby_chick: :chipmunk: :cat2: :cow2:
blank | 2025feb_laki dboar 2025feb_jose gained 68xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 25 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 16 :bee: - no weapon
L. 16 :butterfly: - uncommonuvampstaffchp
L. 16 :snail: - rarerhealstaffekkaze

molten glen
#

Wah

hexed forumBOT
#

rbot | BEEP BOOP. I AM BACK WITH 1005 ANIMALS,
blank | 15797 ESSENCE, AND 20870 EXPERIENCE
common | :snail:¹¹⁹ :bug:¹²⁡ :bee:¹³⁡ :beetle:¹¹⁢ :butterfly:¹⁰³
uncommon | :baby_chick:⁰⁷¹ :rooster:⁰⁢⁴ :rabbit2:⁰⁡⁢ :chipmunk:⁰⁢⁰ :mouse2:⁰⁡³
rare | :cow2:⁰¹⁴ :cat2:⁰¹⁢ :pig2:⁰²⁢ :dog2:⁰²⁰ :sheep:⁰¹⁸
epic | :elephant:⁰⁰² :tiger2:⁰⁰² :penguin:⁰⁰⁴ :whale:⁰⁰¹

molten glen
#

Whb 5000

hexed forumBOT
#

rbot | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, Here is your password!
blank | Use the command owo autohunt 5000 {password}

molten glen
#

Owo autohunt 5000 vjmcq

hexed forumBOT
#

rbot | BEEP BOOP. π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, YOU SPENT 4,998 cowoncy
blank | I WILL BE BACK IN 7H23M WITH 833 ANIMALS,
blank | 13105 ESSENCE, AND 17313 EXPERIENCE

molten glen
#

Owo sac all

hexed forumBOT
#

πŸ”ͺ | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ sacrificed uncommonx502 commonx1018 rarex171 epicx13 legendaryx1 for a total of essence 20,198

molten glen
#

Wah

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡'s HuntBot
`BEEP. BOOP. I AM HUNTBOT. I WILL HUNT FOR YOU MASTER.`

Use the command owo autohunt {cowoncy} to get started.
You can use owo upgrade {trait} {count} to upgrade the traits below.
To obtain more essence, use owo sacrifice {animal} {count}.

⏱ Efficiency - `113/H`

Lvl 88 [12815/25558]
[β– β– β– β– β– β– β– β– β– β–‘β–‘β–‘β–‘β–‘β–‘β–‘]

⏳ Duration - `8.9H`

Lvl 84 [30/19055]
[β– β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘]

<:cowoncy:416043450337853441> Cost - `6 cowoncy`

Lvl 4 [98965/237956]
[β– β– β– β– β– β– β– β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘]

πŸ”§ Gain - `1775 essence/H`

Lvl 71 [15431/22039]
[β– β– β– β– β– β– β– β– β– β– β– β– β–‘β–‘β–‘β–‘]

βš” Experience - `2345 xp/H`

Lvl 67 [28/19884]
[β– β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘]

πŸ“‘ Radar - `0.00007 %`

Lvl 18 [1823/78678]
[β– β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘]

<a:essence:451638978299428875> Animal Essence - `224,977`

Current Max Autohunt: 1,005 animals, 15,797 essence, and 20,870 xp for 6,030 cowoncy

<:rbot:459996049361338379> HUNTBOT is currently hunting!

BEEP BOOP. I AM STILL HUNTING. I WILL BE BACK IN 7H 23M
0% DONE | 0 ANIMALS CAPTURED
[β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘]

molten glen
#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by egem1[73/75] lgem3[436/800] lgem4[100/800] !
blank | You found: :bug: :bug: :butterfly: :snail: :snail: :snail: :baby_chick: :baby_chick: :mouse2: :rabbit2: :rabbit2: :pig2:
blank | 2025feb_laki dboar 2025feb_jose gained 76xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 26 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 6 :ghost: - no weapon

molten glen
#

Owo

#

My!work

clear cryptBOT
#
glass.spells

You helped set up a friend’s party decorations, and they rewarded you with zenis.
Work +10 Zeni
<@&580565140420821013> +10 Zeni

molten glen
#

My!dt

clear cryptBOT
#
Guess the anime:

Hint: F-fn-r o- --- B--- Sk-

molten glen
#

Fafner in the blue sky

#

Radner of the blue sky

#

Fafner of the blue sky

clear cryptBOT
#
Amazing

Congrats you got it right and you got 50 Zeni!

molten glen
#

My!work

clear cryptBOT
#
glass.spells

You've been a good slave.
Work +10 Zeni
<@&580565140420821013> +10 Zeni

molten glen
#

Owo

#

Wh

#

Wb

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by egem1[72/75] lgem3[430/800] lgem4[94/800] !
blank | You found: :bee: :bee: :bee: :beetle: :beetle: :beetle: :bug: :chipmunk: :chipmunk: :rabbit2: :rooster: :cat2:
blank | 2025feb_laki dboar 2025feb_jose gained 67xp!

#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 26 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 23 dfrog - mythicmrstaffmlifesteal
L. 23 gdeer - mythicpmgaxempr
L. 23 gfox - mythicmestafflhgen

primal swallow
#

My!heart @molten glen

clear cryptBOT
#
arty.4255

Successs | Successfully given a Heart to @molten glen!

primal swallow
#

My!daily

clear cryptBOT
#
arty.4255

You claimed your daily!
Daily +15 Zeni

<@&1005357685522313266> +30 Zeni

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by egem1[71/75] lgem3[424/800] lgem4[88/800] !
blank | You found: :bee: :beetle: :bug: :bug: :butterfly: :butterfly: :butterfly: :butterfly: :snail: :mouse2: :mouse2: :rooster:
blank | 2025feb_laki dboar 2025feb_jose gained 39xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 26 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 10 :snail: - no weapon

molten glen
#

My!cd

clear cryptBOT
#
glass.spells's Cooldowns
Daily Command

2h, 46m, 48s

Heart Command

4h, 43m, 28s

molten glen
#

My!work

clear cryptBOT
#
glass.spells

You helped Futaro tutor the quintuplets, earning zenis for your patience.
Work +10 Zeni
<@&580565140420821013> +10 Zeni

molten glen
#

Wpat @primal swallow

primal swallow
#

Wcl

hexed forumBOT
#
ʚ Certy ɞ's Checklist

⬛ 🎁 You can still claim your daily!
⬛ πŸ“ You can claim your vote!
β˜‘οΈ πŸͺ You have used your cookie!
⬛ πŸ“œ You can still claim a quest! (+rr)
⬛ πŸ’Ž 3 lootboxes can be found from hunting!
⬛ βš” 3 weapon crates can be found from battling!
⬛ πŸŽ‰ Complete your checklist to get a reward!

primal swallow
#

Wq

hexed forumBOT
#
ʚ Certy ɞ's Quest Log

These quests belong to @primal swallow
1. Battle with a friend 3 times!blankβ€£ Reward: boxbox
blankβ€£ Progress: [0/3]

primal swallow
#

Wvote

hexed forumBOT
#

βœ… | Your daily vote is available!
blank | You can vote every 12 hours!

ruby sedge
#

Wpray

hexed forumBOT
#

πŸ™ | @ruby sedge prays... May luck be in your favor.
blank | You have 254 luck point(s)!

ruby sedge
#

My!p

clear cryptBOT
#
suite69's profile | Zeni: 45,549
molten glen
#

My!work

clear cryptBOT
#
glass.spells

You joined Hiro in a Franxx training session, earning zenis for your support.
Work +10 Zeni
<@&580565140420821013> +10 Zeni

molten glen
#

Wbattle @primal swallow

hexed forumBOT
#

@primal swallow

ʚ Certy ɞ, π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ challenges you to a duel!

owo ab to accept the battle!
owo db to decline the battle!

beelz | 2 wins

L.25 2025feb_laki 2025feb_laki | mythicmorbemrlsnail 86%
L.25 dboar dboar | mythicpmrstaffepr 83%
L.26 2025feb_jose 2025feb_jose | mythicmshieldmwgen 89%

<:certy:1312971012555407422> | 0 wins

L.24 2025feb_jose SQUAWKS | mythicmrstaffesac 85%
L.32 dgorilla DK | mythicmrstafflsac 86%
L.32 2024dec_mrelephant Mr. FBI Lawyer. | epiceshieldrsac 70%

molten glen
#

Wcurse @rigid copper

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 26 2025feb_jose - mythicmshieldmwgen

<:certy:1312971012555407422>

L. 24 2025feb_jose - mythicmrstaffesac
L. 32 dgorilla - mythicmrstafflsac
L. 32 2024dec_mrelephant - epiceshieldrsac

#

πŸ‘» | @molten glen puts a curse on @rigid copper! I've got a bad feeling about this...
blank | You have 484 luck point(s)!

primal swallow
#

Wb @molten glen

hexed forumBOT
#

@molten glen

π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, ʚ Certy ɞ challenges you to a duel!

owo ab to accept the battle!
owo db to decline the battle!

<:certy:1312971012555407422> | 0 wins

L.24 2025feb_jose SQUAWKS | mythicmrstaffesac 85%
L.32 dgorilla DK | mythicmrstafflsac 86%
L.32 2024dec_mrelephant Mr. FBI Lawyer. | epiceshieldrsac 70%

beelz | 3 wins

L.25 2025feb_laki 2025feb_laki | mythicmorbemrlsnail 86%
L.25 dboar dboar | mythicpmrstaffepr 83%
L.26 2025feb_jose 2025feb_jose | mythicmshieldmwgen 89%

#
ʚ Certy ɞ goes into battle!
<:certy:1312971012555407422>

L. 24 2025feb_jose - mythicmrstaffesac
L. 32 dgorilla - mythicmrstafflsac
L. 32 2024dec_mrelephant - epiceshieldrsac

beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 26 2025feb_jose - mythicmshieldmwgen

molten glen
#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by egem1[70/75] lgem3[418/800] lgem4[82/800] !
blank | You found: :bee: :beetle: :bug: :bug: :bug: :bug: :butterfly: :butterfly: :snail: :snail: :chipmunk: :cat2:
blank | 2025feb_laki dboar 2025feb_jose gained 40xp!

molten glen
#

Wbattle @primal swallow

hexed forumBOT
#

@primal swallow

ʚ Certy ɞ, π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ challenges you to a duel!

owo ab to accept the battle!
owo db to decline the battle!

beelz | 4 wins

L.25 2025feb_laki 2025feb_laki | mythicmorbemrlsnail 86%
L.25 dboar dboar | mythicpmrstaffepr 83%
L.26 2025feb_jose 2025feb_jose | mythicmshieldmwgen 89%

<:certy:1312971012555407422> | 0 wins

L.24 2025feb_jose SQUAWKS | mythicmrstaffesac 85%
L.32 dgorilla DK | mythicmrstafflsac 86%
L.32 2024dec_mrelephant Mr. FBI Lawyer. | epiceshieldrsac 70%

#

πŸ“œ | arty.4255! You finished a quest and earned: boxbox!

#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 26 2025feb_jose - mythicmshieldmwgen

<:certy:1312971012555407422>

L. 24 2025feb_jose - mythicmrstaffesac
L. 32 dgorilla - mythicmrstafflsac
L. 32 2024dec_mrelephant - epiceshieldrsac

primal swallow
#

Yay, thank you sweetie

molten glen
#

Whug @primal swallow

primal swallow
molten glen
primal swallow
#

Wcuddle @molten glen

molten glen
#

Kawaii

primal swallow
#

W pic neko

hexed forumBOT
molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by egem1[69/75] lgem3[412/800] lgem4[76/800] !
blank | You found: :bee: :beetle: :beetle: :butterfly: :snail: :snail: :snail: :snail: :mouse2: :rabbit2: :rabbit2: :rooster:
blank | 2025feb_laki dboar 2025feb_jose gained 48xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 26 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 19 :mouse2: - rarervampstaffrwp
L. 19 :rooster: - rarersstaffrthorns
L. 19 :rabbit2: - no weapon

molten glen
#

My!cf

#

My!cd

clear cryptBOT
#
glass.spells's Cooldowns
Daily Command

2h, 27m, 30s

Heart Command

4h, 24m, 9s

Work Command

20s

molten glen
#

My!work

clear cryptBOT
#
glass.spells

You cleaned up the beach and found a shiny zeni hidden in the sand.
Work +10 Zeni
<@&580565140420821013> +10 Zeni

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by egem1[68/75] lgem3[406/800] lgem4[70/800] !
blank | You found: :bee: :bee: :beetle: :butterfly: :snail: :snail: :snail: :chipmunk: :mouse2: :rabbit2: :rooster: :penguin:
blank | 2025feb_laki dboar 2025feb_jose gained 447xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 26 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 15 :snail: - no weapon
L. 15 :bee: - no weapon
L. 15 :bug: - no weapon

molten glen
#

Wbully @fast glacier

molten glen
#

My!cd

clear cryptBOT
#
glass.spells's Cooldowns
Daily Command

2h, 23m, 14s

Heart Command

4h, 19m, 54s

Work Command

3s

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by egem1[67/75] lgem3[400/800] lgem4[64/800] !
blank | You found: :bee: :bee: :bug: :bug: :bug: :baby_chick: :baby_chick: :baby_chick: :rabbit2: :rabbit2: :pig2: :penguin:
blank | 2025feb_laki dboar 2025feb_jose gained 475xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 26 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 17 :cow2: - no weapon
L. 17 :pig2: - no weapon
L. 17 :dog2: - no weapon

molten glen
#

My!work

clear cryptBOT
#
glass.spells

You fought alongside Yuichiro against vampires, earning zenis for your bravery.
Work +10 Zeni
<@&580565140420821013> +10 Zeni

molten glen
#

Owo

#

Wcurse @rigid copper

hexed forumBOT
#

πŸ‘» | @molten glen puts a curse on @rigid copper! You feel unlucky...
blank | You have 485 luck point(s)!

molten glen
#

Wdance

sour junco
#

s!cuddle @fallow swan

shadow phoenixBOT
#

@sour junco cuddles @fallow swan!

quaint locust
#

Wh

hexed forumBOT
#

🌱 | Capi, hunt is empowered by lgem1[61/100] !
blank | You found: :bee: :bee: :beetle: :butterfly: :snail: :chipmunk: :rabbit2: :rooster:
blank | gowl gsquid gfish gained 35xp!
box | You found a lootbox! [1/3] RESETS IN: 8H 2M 53S

quaint locust
#

Wb

hexed forumBOT
#

crate | Capi, You found a weapon crate! [1/3] RESETS IN: 8H 2M 35S

#
Capi goes into battle!
Player team

L. 29 gowl - epiceshieldldischarge
L. 29 gsquid - mythicpmsstaffmhgen
L. 29 gfish - epicevampstaffemanatap

sad

L. 22 2022valentinesspecial - epiceestaffmmanatap
L. 22 2022valentines - mythicmhealstaffesac
L. 22 gowl - epiceshieldmkkaze

quaint locust
#

Wdaily

hexed forumBOT
#

πŸ’° | Capi, Here is your daily cowoncy 5000 Cowoncy!
blank | You're on a 197 daily streak!
crate | You received a weapon crate!
⏱️ | Your next daily is in: 8H 2M 31S

quaint locust
#

Wah

hexed forumBOT
#

rbot | BEEP BOOP. I AM BACK WITH 1450 ANIMALS,
blank | 18600 ESSENCE, AND 23870 EXPERIENCE
common | :snail:¹⁡² :beetle:¹⁡⁢ :bug:¹⁷⁡ :bee:¹⁢⁹ :butterfly:¹⁹⁰
uncommon | :chipmunk:⁰⁸⁷ :rabbit2:⁰⁸⁰ :baby_chick:⁰⁹⁸ :rooster:⁰⁸⁹ :mouse2:⁰⁹³
rare | :pig2:⁰²⁸ :sheep:⁰²⁡ :cow2:⁰²⁢ :dog2:⁰³⁢ :cat2:⁰²⁷
epic | :tiger2:⁰⁰⁢ :elephant:⁰⁰⁢ :crocodile:⁰⁰¹ :whale:⁰⁰³ :penguin:⁰⁰³

quaint locust
#

Wah 24h

hexed forumBOT
#

rbot | Capi, Here is your password!
blank | Use the command owo autohunt 14040 {password}

quaint locust
#

Wah 24h icjrq

hexed forumBOT
#

rbot | BEEP BOOP. Capi, YOU SPENT 7,250 cowoncy
blank | I WILL BE BACK IN 12H24M WITH 1450 ANIMALS,
blank | 18600 ESSENCE, AND 23870 EXPERIENCE

quaint locust
#

Wh

hexed forumBOT
#

🌱 | Capi, hunt is empowered by lgem1[60/100] !
blank | You found: :bug: :bug: :bug: :bug: :butterfly: :rooster: :dog2: :sheep:
blank | gowl gsquid gfish gained 55xp!

quaint locust
#

Wb

hexed forumBOT
#
Capi goes into battle!
Player team

L. 29 gowl - epiceshieldldischarge
L. 29 gsquid - mythicpmsstaffmhgen
L. 29 gfish - epicevampstaffemanatap

its ramazan no kΓΌfΓΌr

L. 20 :snail: - epiceshieldrmanatap
L. 20 glion - epicesstaffemanatap
L. 20 :unicorn: - mythicmvampstaffmenrage

molten glen
#

My!work

clear cryptBOT
#
glass.spells

You helped Michiru with an emotional farewell, earning zenis for your kindness.
Work +10 Zeni
<@&580565140420821013> +10 Zeni

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by egem1[66/75] lgem3[394/800] lgem4[58/800] !
blank | You found: :bee: :bee: :beetle: :beetle: :butterfly: :butterfly: :butterfly: :snail: :baby_chick: :rabbit2: :rabbit2: :rooster:
blank | 2025feb_laki dboar 2025feb_jose gained 48xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 26 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 16 :cow2: - no weapon
L. 16 :chipmunk: - no weapon
L. 16 :rooster: - no weapon

molten glen
#

Owo

#

My!dt

clear cryptBOT
#
Guess the anime:

Hint: St-e-t Fi-ht-- II: T-- A-im-t-- Mov--

molten glen
#

Street fighter II: the animated movie

clear cryptBOT
#
Amazing

Congrats you got it right and you got 50 Zeni!

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by egem1[65/75] lgem3[388/800] lgem4[52/800] !
blank | You found: :bee: :bee: :bee: :beetle: :beetle: :butterfly: :butterfly: :butterfly: :snail: :snail: :rabbit2: :rabbit2:
blank | 2025feb_laki dboar 2025feb_jose gained 30xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 26 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 18 :bee: - no weapon
L. 18 :butterfly: - rarervbanrwgen
L. 18 :snail: - epiceestaffehgen

molten glen
#

Owo

#

Wcurse @rigid copper

hexed forumBOT
#

πŸ‘» | @molten glen puts a curse on @rigid copper! Oh no.
blank | You have 486 luck point(s)!

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by egem1[64/75] lgem3[382/800] lgem4[46/800] !
blank | You found: :bee: :beetle: :bug: :bug: :bug: :bug: :butterfly: :snail: :baby_chick: :rooster: :pig2: :pig2:
blank | 2025feb_laki dboar 2025feb_jose gained 68xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 26 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 16 :tiger2: - no weapon
L. 16 :rabbit2: - no weapon
L. 16 :baby_chick: - no weapon

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by egem1[63/75] lgem3[376/800] lgem4[40/800] !
blank | You found: :bee: :bee: :beetle: :butterfly: :butterfly: :snail: :baby_chick: :baby_chick: :baby_chick: :mouse2: :rooster: :dog2:
blank | 2025feb_laki dboar 2025feb_jose gained 76xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 26 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 30 2024may_flower - epicerstaffesac
L. 30 2024may_esd - rarerrstaffrsac
L. 30 2024may_mothersday - epiceshieldmsac

molten glen
#

Owo

#

My!cd

clear cryptBOT
#
glass.spells's Cooldowns
Daily Command

1h, 55m, 42s

Heart Command

3h, 52m, 22s

molten glen
#

My!work

clear cryptBOT
#
glass.spells

You provided information on a boss's weaknesses, earning zenis for your insights.
Work +10 Zeni
<@&580565140420821013> +10 Zeni

molten glen
#

My!work

clear cryptBOT
#
glass.spells

You provided Migi with analysis on a new threat, receiving zenis for your insights.
Work +10 Zeni
<@&580565140420821013> +10 Zeni

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by egem1[62/75] lgem3[370/800] lgem4[34/800] !
blank | You found: :bee: :bee: :bug: :butterfly: :snail: :snail: :snail: :snail: :baby_chick: :chipmunk: :rabbit2: :rooster:
blank | 2025feb_laki dboar 2025feb_jose gained 48xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 26 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 17 :sheep: - no weapon
L. 17 :mouse2: - no weapon
L. 17 :bee: - no weapon

molten glen
#

Wcurse @rigid copper

hexed forumBOT
#

πŸ‘» | @molten glen puts a curse on @rigid copper! I've got a bad feeling about this...
blank | You have 487 luck point(s)!

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by egem1[61/75] lgem3[364/800] lgem4[28/800] !
blank | You found: :bee: :bee: :bee: :bee: :bee: :beetle: :butterfly: :snail: :baby_chick: :chipmunk: :mouse2: :cow2:
blank | 2025feb_laki dboar 2025feb_jose gained 58xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 26 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 17 :cat2: - no weapon
L. 17 :rooster: - no weapon
L. 17 :pig2: - no weapon

molten glen
#

Owo

#

My!dt

clear cryptBOT
#
Guess the anime:

Hint: Ber--r-

molten glen
#

Berserk

clear cryptBOT
#
Amazing

Congrats you got it right and you got 50 Zeni!

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by egem1[60/75] lgem3[358/800] lgem4[22/800] !
blank | You found: :bee: :beetle: :bug: :bug: :bug: :butterfly: :butterfly: :baby_chick: :chipmunk: :cat2: :penguin: :dove:
blank | 2025feb_laki dboar 2025feb_jose gained 1447xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 26 2025feb_jose - mythicmshieldmwgen

Azra disini

L. 19 gspider - mythicmbowmwp
L. 19 gpanda - epicegaxermanatap
L. 19 :snail: - mythicmshieldmkkaze

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by egem1[59/75] lgem3[352/800] lgem4[16/800] !
blank | You found: :bee: :bee: :bee: :bug: :bug: :butterfly: :butterfly: :baby_chick: :rabbit2: :rooster: :sheep: :sheep:
blank | 2025feb_laki dboar 2025feb_jose gained 77xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 26 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 13 :dog2: - no weapon

molten glen
#

Owo

#

My!cd

clear cryptBOT
#
glass.spells's Cooldowns
Daily Command

1h, 48m, 40s

Heart Command

3h, 45m, 20s

Dailytrivia Command

1m, 55s

Work Command

1m, 9s

molten glen
#

Owo

#

Warmy

hexed forumBOT
#

broken | Scavenging through the messages, you found the really old relic of the past! Shattered Army Emblem!! So old it turned to dust as you picked it up. :(
blank | Today's remaining Broken Army Emblem : 2

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by egem1[58/75] lgem3[346/800] lgem4[10/800] !
blank | You found: :bee: :bee: :beetle: :bug: :butterfly: :butterfly: :snail: :chipmunk: :chipmunk: :chipmunk: :mouse2: :sheep:
blank | 2025feb_laki dboar 2025feb_jose gained 67xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 26 2025feb_jose - mythicmshieldmwgen

:noooooo:

L. 19 :dog2: - rarerbowmmanatap
L. 19 :butterfly: - uncommonusstaffethorns
L. 19 :snail: - rarershieldcatt

waxen walrus
#

wh

hexed forumBOT
#

🌱 | filo destroyer, hunt is empowered by egem1[40/75] egem3[240/450] egem4[240/450] !
blank | You found: :bee: :beetle: :beetle: :bug: :butterfly: :snail: :snail: :baby_chick: :chipmunk: :rooster: :cat2: :sheep:
blank | gspider 2023halloween_floofy gowl gained 77xp!

waxen walrus
#

wb

hexed forumBOT
#
filo destroyer goes into battle!
no

L. 32 gspider - rarersytheusac
L. 32 2023halloween_floofy - epicepdaggerrsac
L. 32 gowl - epicerstaffesac

Enemy team

L. 16 :tiger2: - no weapon
L. 16 :elephant: - no weapon
L. 16 :whale: - no weapon

waxen walrus
#

wpray

hexed forumBOT
#

πŸ™ | @keen silo prays... Luck is on your side!
blank | You have 1763 luck point(s)!

waxen walrus
#

whb 1

#

whb 1

hexed forumBOT
#

rbot | BEEP BOOP. I AM STILL HUNTING. I WILL BE BACK IN 6H 4M
blank | 60.08% DONE | 1753 ANIMALS CAPTURED
blank | [β– β– β– β– β– β– β– β– β– β– β– β– β– β– β– β– β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘]

waxen walrus
#

warmy

hexed forumBOT
#

earthly | Scavenging through the messages, you found the mighty Earthly Army Emblem!! yessir
blank | Today's remaining Broken Army Emblem : 13

waxen walrus
#

wpup

hexed forumBOT
#

puppy | You picked up one puppy!!
blank | You adopted 2/6 puppies today!
blank | You adopted 713 puppies in total!

waxen walrus
#

wpiku

hexed forumBOT
#

πŸ₯• | You picked one PikPik carrot!
blank | You harvested 2/6 today!
blank | You have 684 carrots in total!

molten glen
#

My!work

clear cryptBOT
#
glass.spells

You sang your heart out at karaoke night, and someone handed you a zeni for the performance.
Work +10 Zeni
<@&580565140420821013> +10 Zeni

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by egem1[57/75] lgem3[340/800] lgem4[4/800] !
blank | You found: :bee: :bee: :bee: :beetle: :bug: :butterfly: :butterfly: :snail: :mouse2: :mouse2: :pig2: :pig2:
blank | 2025feb_laki dboar 2025feb_jose gained 68xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 26 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 15 :rabbit2: - no weapon
L. 15 :butterfly: - no weapon

molten glen
#

My!work

clear cryptBOT
#
glass.spells

You taught a friend how to draw in anime style, and they rewarded you with zenis.
Work +10 Zeni
<@&580565140420821013> +10 Zeni

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by egem1[56/75] lgem3[334/800] lgem4[0/800] !
blank | You found: :bee: :beetle: :beetle: :beetle: :bug: :butterfly: :butterfly: :chipmunk: :mouse2: :rabbit2: :sheep: :crocodile:
blank | 2025feb_laki dboar 2025feb_jose gained 457xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 26 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 20 :dragon: - epicepdaggermatt
L. 20 gpanda - epicesstaffmsafeguard
L. 20 gspider - rarerorbusafeguardesprout

violet tangle
#

owo h

hexed forumBOT
#

🌱 | tianshi, hunt is empowered by egem1[58/75] fgem4[432/1000] mgem3[489/525] !
blank | You found: :bee: :beetle: :beetle: :beetle: :bug: :snail: :chipmunk: :chipmunk: :chipmunk: :mouse2: :rooster: :crocodile:
blank | gfish 2025feb_jose :dragon: gained 456xp!
box | You found a lootbox! [1/3] RESETS IN: 7H 16M 46S

violet tangle
#

owo lb

hexed forumBOT
#

egem3 | tianshi opens a lootbox
boxopen | and finds an Epic Empowering Gem!

waxen walrus
#

wh

hexed forumBOT
#

🌱 | filo destroyer, hunt is empowered by egem1[39/75] egem3[234/450] egem4[234/450] !
blank | You found: :bee: :beetle: :bug: :bug: :butterfly: :snail: :chipmunk: :dog2: :dog2: :dog2: :sheep: :elephant:
blank | gspider 2023halloween_floofy gowl gained 496xp!

waxen walrus
#

wb

hexed forumBOT
#
filo destroyer goes into battle!
no

L. 32 gspider - rarersytheusac
L. 32 2023halloween_floofy - epicepdaggerrsac
L. 32 gowl - epicerstaffesac

> H β€” Xtreme | Build

L. 32 2024aug_maki - epicerstaffrsac
L. 32 chie - mythicmshieldmsac
L. 32 dgorilla - epicerstaffesac

waxen walrus
#

wpray

hexed forumBOT
#

πŸ™ | @keen silo prays... You can feel the luck within you!
blank | You have 1764 luck point(s)!

waxen walrus
#

owo

#

wrun

#

wpup

hexed forumBOT
#

puppy | You picked up one puppy!!
blank | You adopted 3/6 puppies today!
blank | You adopted 714 puppies in total!

waxen walrus
#

wrun

hexed forumBOT
#

run | You ran 2/5 kilometers today!
blank | Total distance traveled: 604km

waxen walrus
#

wpup

#

wpiku

#

warmy

hexed forumBOT
#

earthly | Scavenging through the messages, you found the mighty Earthly Army Emblem!! yessir
blank | Today's remaining Broken Army Emblem : 12

waxen walrus
#

owo hb 1

hexed forumBOT
#

rbot | BEEP BOOP. I AM STILL HUNTING. I WILL BE BACK IN 5H 22M
blank | 64.69% DONE | 1887 ANIMALS CAPTURED
blank | [β– β– β– β– β– β– β– β– β– β– β– β– β– β– β– β– β– β–‘β–‘β–‘β–‘β–‘β–‘β–‘β–‘]

waxen walrus
#

wq

hexed forumBOT
#
filo destroyer's Quest Log

These quests belong to @keen silo
1. Have a friend use an action command on you 1 times!blankβ€£ Reward: 200 cowoncy
blankβ€£ Progress: [0/1]
2. Hunt 3 animals that are mythical rank!blankβ€£ Reward: boxboxboxboxboxboxboxbox
blankβ€£ Progress: [0/3]
3. Have a friend use an action command on you 3 times!blankβ€£ Reward: cratecrate
blankβ€£ Progress: [2/3]

waxen walrus
#

wq rr 1

#

dies

#

owo h

hexed forumBOT
#

🌱 | filo destroyer, hunt is empowered by egem1[38/75] egem3[228/450] egem4[228/450] !
blank | You found: :bug: :butterfly: :butterfly: :butterfly: :butterfly: :butterfly: :chipmunk: :mouse2: :mouse2: :rabbit2: :rabbit2: :rooster:
blank | gspider 2023halloween_floofy gowl gained 66xp!

waxen walrus
#

owo b

hexed forumBOT
#
filo destroyer goes into battle!
no

L. 32 gspider - rarersytheusac
L. 32 2023halloween_floofy - epicepdaggerrsac
L. 32 gowl - epicerstaffesac

Enemy team

L. 23 gspider - epicebowrcritical
L. 23 gdeer - mythicmestaffedischarge
L. 22 dboar - rarershieldehp

waxen walrus
#

owo

#

my!cd

clear cryptBOT
#
filo destroyer's Cooldowns
Heart Command

11h, 59m, 18s

waxen walrus
#

my!work

clear cryptBOT
#
filo destroyer

You supported Ashiya during a tough shift, earning zenis for your dedication.
Work +10 Zeni
<@&580565140420821013> +10 Zeni

waxen walrus
#

my!daily

clear cryptBOT
#
filo destroyer

You claimed your daily!
Daily +15 Zeni
<@&580565140420821013> +15 Zeni

<@&1005357685522313266> +30 Zeni

waxen walrus
#

wh

hexed forumBOT
#

🌱 | filo destroyer, hunt is empowered by egem1[37/75] egem3[222/450] egem4[222/450] !
blank | You found: :bee: :bee: :bee: :bug: :snail: :snail: :baby_chick: :baby_chick: :mouse2: :rabbit2: :rooster: :rooster:
blank | gspider 2023halloween_floofy gowl gained 66xp!

waxen walrus
#

wb

hexed forumBOT
#
filo destroyer goes into battle!
no

L. 32 gspider - rarersytheusac
L. 32 2023halloween_floofy - epicepdaggerrsac
L. 32 gowl - epicerstaffesac

:uwu: DADDY

L. 23 :snowman2: - epicehealstaffewp
L. 23 :dragon: - mythicmgreatswordratt
L. 23 gfox - epicefstaffmmr

waxen walrus
#

wpray

#

owo

#

wpray

hexed forumBOT
#

πŸ™ | @keen silo prays... You feel very lucky!
blank | You have 1765 luck point(s)!

waxen walrus
#

owo cash

hexed forumBOT
#

cowoncy | filo destroyer, you currently have 9,876,423 cowoncy!

waxen walrus
#

owo cf all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose heads
The coin spins... head and you won cowoncy 500,000!!

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
eggplant cowoncy heart filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo bj all

hexed forumBOT
#
hwlo, you bet 250,000 to play blackjack
Dealer `[25]`

5s khf kdf

hwlo `[19]`

jd 9s

waxen walrus
#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... head and you lost it all... :c

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
heart heart eggplant filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo cf all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose heads
The coin spins... tail and you lost it all... :c

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
heart heart heart filo destroyer bet cowoncy 250,000
| | and won cowoncy 500,000
| |

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
eggplant eggplant eggplant filo destroyer bet cowoncy 250,000
| | and won cowoncy 250,000
| |

waxen walrus
#

owo slots all

#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
heart heart heart filo destroyer bet cowoncy 250,000
| | and won cowoncy 500,000
| |

waxen walrus
#

owo slots all

#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
cowoncy eggplant cherry filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo cf all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose heads
The coin spins... tail and you lost it all... :c

waxen walrus
#

owo bj all

hexed forumBOT
#
hwlo, you bet 250,000 to play blackjack
Dealer `[17]`

ad 6hf

hwlo `[16]`

6c 10h

waxen walrus
#

owo cash

hexed forumBOT
#

cowoncy | filo destroyer, you currently have 9,126,423 cowoncy!

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
cowoncy cowoncy heart filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... tail and you won cowoncy 500,000!!

waxen walrus
#

owo cf t all

#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... tail and you won cowoncy 500,000!!

waxen walrus
#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... tail and you won cowoncy 500,000!!

waxen walrus
#

owo cf t all

#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... tail and you won cowoncy 500,000!!

waxen walrus
#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... head and you lost it all... :c

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
eggplant eggplant cowoncy filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo slots all

#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... tail and you won cowoncy 500,000!!

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
cherry cherry eggplant filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo cf all

#

owo cf all

#

owo cf all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose heads
The coin spins... head and you won cowoncy 500,000!!

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
heart heart heart filo destroyer bet cowoncy 250,000
| | and won cowoncy 500,000
| |

waxen walrus
#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... tail and you won cowoncy 500,000!!

waxen walrus
#

owo cf all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose heads
The coin spins... tail and you lost it all... :c

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
cowoncy heart eggplant filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo bj all

hexed forumBOT
#
hwlo, you bet 250,000 to play blackjack
Dealer `[23]`

2s 3cf 3hf 7df 8hf

hwlo `[19]`

4c 5s 10d

waxen walrus
#

owo slots all

#

owo cf all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose heads
The coin spins... tail and you lost it all... :c

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
eggplant eggplant eggplant filo destroyer bet cowoncy 250,000
| | and won cowoncy 250,000
| |

waxen walrus
#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... tail and you won cowoncy 500,000!!

waxen walrus
#

owo cf all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose heads
The coin spins... head and you won cowoncy 500,000!!

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
o_ cowoncy cowoncy filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo cf t all

#

owo cf t all

#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... tail and you won cowoncy 500,000!!

waxen walrus
#

owo cf t all

#

owo cf t all

#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... head and you lost it all... :c

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
cherry heart o_ filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo cf t all

#

owo cf t all

#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... tail and you won cowoncy 500,000!!

waxen walrus
#

owo cf all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose heads
The coin spins... tail and you lost it all... :c

waxen walrus
#

owo cf t all

#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
eggplant cowoncy cherry filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... head and you lost it all... :c

waxen walrus
#

owo cash

hexed forumBOT
#

cowoncy | filo destroyer, you currently have 9,126,423 cowoncy!

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
heart cherry cherry filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo slots all

#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
heart cowoncy eggplant filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
eggplant eggplant eggplant filo destroyer bet cowoncy 250,000
| | and won cowoncy 250,000
| |

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
cowoncy cowoncy cowoncy filo destroyer bet cowoncy 250,000
| | and won cowoncy 1,000,000
| |

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
cherry cherry cherry filo destroyer bet cowoncy 250,000
| | and won cowoncy 750,000
| |

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
heart heart heart filo destroyer bet cowoncy 250,000
| | and won cowoncy 500,000
| |

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
heart heart heart filo destroyer bet cowoncy 250,000
| | and won cowoncy 500,000
| |

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
eggplant heart cherry filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... head and you lost it all... :c

waxen walrus
#

owo bj all

hexed forumBOT
#
hwlo, you bet 250,000 to play blackjack
Dealer `[17]`

4h 5hf 8cf

hwlo `[17]`

5d 3c 5c 4s

waxen walrus
#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... tail and you won cowoncy 500,000!!

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
heart heart heart filo destroyer bet cowoncy 250,000
| | and won cowoncy 500,000
| |

waxen walrus
#

owo cf all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose heads
The coin spins... head and you won cowoncy 500,000!!

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
eggplant cherry o_ filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... tail and you won cowoncy 500,000!!

waxen walrus
#

owo cf all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose heads
The coin spins... head and you won cowoncy 500,000!!

waxen walrus
#

owo cf t all

#

owo cf t all

#

bro

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... head and you lost it all... :c

waxen walrus
#

owo cf all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose heads
The coin spins... head and you won cowoncy 500,000!!

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
cowoncy cowoncy cowoncy filo destroyer bet cowoncy 250,000
| | and won cowoncy 1,000,000
| |

waxen walrus
#

owo cf all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose heads
The coin spins... tail and you lost it all... :c

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
heart heart heart filo destroyer bet cowoncy 250,000
| | and won cowoncy 500,000
| |

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
cowoncy w_ o_ filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... tail and you won cowoncy 500,000!!

waxen walrus
#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... head and you lost it all... :c

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
cherry cherry cowoncy filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... tail and you won cowoncy 500,000!!

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
eggplant eggplant eggplant filo destroyer bet cowoncy 250,000
| | and won cowoncy 250,000
| |

waxen walrus
#

owo cf all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose heads
The coin spins... head and you won cowoncy 500,000!!

waxen walrus
#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... head and you lost it all... :c

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
eggplant eggplant eggplant filo destroyer bet cowoncy 250,000
| | and won cowoncy 250,000
| |

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
eggplant eggplant eggplant filo destroyer bet cowoncy 250,000
| | and won cowoncy 250,000
| |

waxen walrus
#

boy

#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
eggplant heart cowoncy filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo bj all

hexed forumBOT
#
hwlo, you bet 250,000 to play blackjack
Dealer `[18]`

5d 9df 4cf

hwlo `[20]`

2s 8c qs

waxen walrus
#

owo cf all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose heads
The coin spins... head and you won cowoncy 500,000!!

waxen walrus
#

owo bj all

hexed forumBOT
#
hwlo, you bet 250,000 to play blackjack
Dealer `[21]`

ad kdf

hwlo `[24]`

8c 6d qdf

waxen walrus
#

owo cf all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose heads
The coin spins... head and you won cowoncy 500,000!!

waxen walrus
#

owo cf all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose heads
The coin spins... tail and you lost it all... :c

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
cherry heart cherry filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
cherry cherry heart filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
heart heart heart filo destroyer bet cowoncy 250,000
| | and won cowoncy 500,000
| |

waxen walrus
#

owo cash

hexed forumBOT
#

cowoncy | filo destroyer, you currently have 11,126,423 cowoncy!

waxen walrus
#

owo slots all

#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
heart heart heart filo destroyer bet cowoncy 250,000
| | and won cowoncy 500,000
| |

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
eggplant heart o_ filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... head and you lost it all... :c

waxen walrus
#

owo cash

hexed forumBOT
#

cowoncy | filo destroyer, you currently have 10,876,423 cowoncy!

waxen walrus
#

arg

#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
cherry eggplant cherry filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
heart heart heart filo destroyer bet cowoncy 250,000
| | and won cowoncy 500,000
| |

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
eggplant eggplant eggplant filo destroyer bet cowoncy 250,000
| | and won cowoncy 250,000
| |

waxen walrus
#

owo slots all

#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
eggplant cowoncy eggplant filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo cf all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose heads
The coin spins... head and you won cowoncy 500,000!!

waxen walrus
#

owo bj all

hexed forumBOT
#
hwlo, you bet 250,000 to play blackjack
Dealer `[23]`

6h 7sf ksf

hwlo `[19]`

jh 9h

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
cherry cowoncy o_ filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... head and you lost it all... :c

waxen walrus
#

owo cash

hexed forumBOT
#

cowoncy | filo destroyer, you currently have 10,626,423 cowoncy!

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
eggplant eggplant eggplant filo destroyer bet cowoncy 250,000
| | and won cowoncy 250,000
| |

waxen walrus
#

owo bj all

hexed forumBOT
#
hwlo, you bet 250,000 to play blackjack
Dealer `[25]`

ac 4hf kcf ksf

hwlo `[26]`

9s 5s 2h kdf

waxen walrus
#

fook

#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
heart cowoncy o_ filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
cowoncy cowoncy cowoncy filo destroyer bet cowoncy 250,000
| | and won cowoncy 1,000,000
| |

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
cowoncy eggplant cowoncy filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

k y s

#

owo cf all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose heads
The coin spins... tail and you lost it all... :c

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
heart eggplant cowoncy filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo bj all

hexed forumBOT
#
hwlo, you bet 250,000 to play blackjack
Dealer `[20]`

jc jdf

hwlo `[20]`

10d 2h 3c 5d

waxen walrus
#

broooo

#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... head and you lost it all... :c

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
heart heart heart filo destroyer bet cowoncy 250,000
| | and won cowoncy 500,000
| |

waxen walrus
#

owo bj all

hexed forumBOT
#
hwlo, you bet 250,000 to play blackjack
Dealer `[17]`

2c 10df 5hf

hwlo `[22]`

5c as 9d 7sf

waxen walrus
#

owo cf t all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose tails
The coin spins... tail and you won cowoncy 500,000!!

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
o_ heart cowoncy filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo bj all

hexed forumBOT
#
hwlo, you bet 250,000 to play blackjack
Dealer `[20]`

kh jdf

hwlo `[17]`

10d 7s

waxen walrus
#

owo cash

hexed forumBOT
#

cowoncy | filo destroyer, you currently have 9,876,423 cowoncy!

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
eggplant eggplant heart filo destroyer bet cowoncy 250,000
| | and won nothing... :c
| |

waxen walrus
#

owo cf all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose heads
The coin spins... head and you won cowoncy 500,000!!

waxen walrus
#

owo cf all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose heads
The coin spins... head and you won cowoncy 500,000!!

waxen walrus
#

owo cf all

hexed forumBOT
#

filo destroyer spent cowoncy 250,000 and chose heads
The coin spins... tail and you lost it all... :c

waxen walrus
#

owo slots all

hexed forumBOT
#

** ___SLOTS___**
heart heart heart filo destroyer bet cowoncy 250,000
| | and won cowoncy 500,000
| |

waxen walrus
#

owo cash

hexed forumBOT
#

cowoncy | filo destroyer, you currently have 10,126,423 cowoncy!

waxen walrus
#

oh well

urban flume
#

$tu

nocturne gladeBOT
#

.eho., you can't claim for another 1h 05 min.
You have 0 rolls left. Next rolls reset in 5 min.
Next $daily reset in 14h 02 min.

You can react to kakera right now!
Power: 105%
Each kakera reaction consumes 30% of your reaction power.
Your characters with 10+ keys consume half the power (15%)
Stock: 854,174kakera

The cooldown of $rt is not over. Time left: 3h 21 min. ($rtu)
Next $dk in 19h 59 min.
You may vote again in 38 min.
=> $tuarrange

waxen walrus
#

owo cookie @ripe hearth

hexed forumBOT
#

cookieeat | @ripe hearth! You got a cookie from @keen silo! nom nom nom c:<

honest lintel
violet tangle
#

we'll have to wait for goku ig

honest lintel
#

Like kfr and then the card code

warped gate
#

Owo cash

hexed forumBOT
#

cowoncy | CReaMoo, you currently have 705,632 cowoncy!

warped gate
#

Owo slots all

hexed forumBOT
#

** ___SLOTS___**
o_ heart o_ CReaMoo bet cowoncy 250,000
| | and won nothing... :c
| |

warped gate
#

Rip

#

Owo BJ all

hexed forumBOT
#
cream005, you bet 250,000 to play blackjack
Dealer `[25]`

6s jdf 9hf

cream005 `[17]`

7c qs

honest lintel
#

Kbi

cobalt jettyBOT
# honest lintel Kbi
Bits

Bits carried by @honest lintel

β—Ύ 1,409 Β· copper bit Β· Copper Bit
β—Ύ 1,326 Β· uranium bit Β· Uranium Bit
β—Ύ 1,228 Β· bone bit Β· Bone Bit
β—Ύ 1,013 Β· wood bit Β· Wood Bit
β—Ύ 434 Β· ice bit Β· Ice Bit
β—Ύ 307 Β· salt bit Β· Salt Bit
β—Ύ 231 Β· leaf bit Β· Leaf Bit
β—Ύ 202 Β· quartz bit Β· Quartz Bit
β—Ύ 188 Β· magma bit Β· Magma Bit
β—Ύ 181 Β· flower bit Β· Flower Bit

honest lintel
#

Km v1dwqz4 copper

cobalt jettyBOT
#
Morph Card

@honest lintel, you are morphing v1dwqz4.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Copper Bits by using the 🎲 button.

#
Morph Card

@honest lintel, you are morphing v1dwqz4.

Apply the morph by using the β˜‘οΈ button.
Reroll for 250 Copper Bits by using the 🎲 button.

The card has been morphed.

honest lintel
#

Ku undead domain frame v1dwqz4

cobalt jettyBOT
honest lintel
#

Kbi

cobalt jettyBOT
# honest lintel Kbi
Bits

Bits carried by @honest lintel

β—Ύ 1,326 Β· uranium bit Β· Uranium Bit
β—Ύ 1,228 Β· bone bit Β· Bone Bit
β—Ύ 1,013 Β· wood bit Β· Wood Bit
β—Ύ 909 Β· copper bit Β· Copper Bit
β—Ύ 434 Β· ice bit Β· Ice Bit
β—Ύ 307 Β· salt bit Β· Salt Bit
β—Ύ 231 Β· leaf bit Β· Leaf Bit
β—Ύ 202 Β· quartz bit Β· Quartz Bit
β—Ύ 188 Β· magma bit Β· Magma Bit
β—Ύ 181 Β· flower bit Β· Flower Bit

honest lintel
#

Ki

cobalt jettyBOT
# honest lintel Ki
Inventory

Items carried by @honest lintel

πŸ’° 2,051 Β· gold Β· Gold
πŸ’Ž 29 Β· gem Β· Gem
🩹 1 · bandage · Bandage
πŸ–ΌοΈ 1 Β· chocolate bunny frame Β· Frame: Chocolate Bunny
πŸ–ΌοΈ 1 Β· rozen frame Β· Frame: Rozen
πŸ–ΌοΈ 1 Β· shadow glass frame Β· Frame: Shadow Glass
πŸ–ΌοΈ 1 Β· undead domain frame Β· Frame: Undead Domain
πŸ–ΌοΈ 1 Β· year of the monkey frame Β· Frame: Year of the Monkey
πŸ–ΌοΈ 1 Β· year of the rooster frame Β· Frame: Year of the Rooster
πŸ–ΌοΈ 1 Β· year of the sheep frame Β· Frame: Year of the Sheep

honest lintel
#

Ku shadow glass frame v1dwqz4

cobalt jettyBOT
honest lintel
#

Ku rozen frame v1dwqz4

cobalt jettyBOT
honest lintel
#

Hmmm

violet tangle
#

oh wow

honest lintel
#

Idk I like the corners

#

Kc c:jonathan

cobalt jettyBOT
# honest lintel Kc c:jonathan
Card Collection

Cards owned by @honest lintel

🌟 vndftqr Β· β˜…β˜…β˜…β˜… Β· #271Β  Β· β—ˆ7 Β· JoJo's Bizarre Adventure Β· Jonathan Joestar
🌟 vzz78p3 Β· β˜…β˜†β˜†β˜† Β· #3374 Β· β—ˆ6 Β· JoJo's Bizarre Adventure Β· Jonathan Joestar

honest lintel
#

Kwi vndftqr

cobalt jettyBOT
# honest lintel Kwi vndftqr
Worker Details

Character Β· Jonathan Joestar (vndftqr)
Effort Β· 246

Healthy

Effort modifiers ```js
88 Base value
49 (S) Wellness
36 (A) Vanity
22 (S) Toughness
18 (S) Quickness
15 (B) Purity
Β 9 (S) Grabber
Β 9 (S) Dropper
Β 0 (F) Style

honest lintel
#

Kc f:y

cobalt jettyBOT
# honest lintel Kc f:y
Card Collection

Cards owned by @honest lintel

πŸ’€ v1k38bg Β· β˜…β˜…β˜…β˜… Β· #64Β Β  Β· β—ˆ7 Β· Maou Gakuin no Futekigousha Β· Anos Voldigoad
πŸ’€ vkw3157 Β· β˜…β˜…β˜…β˜… Β· #536Β  Β· β—ˆ6 Β· Bleach Β· Cuatro Espada
🌟 vbhhrc0 Β· β˜…β˜…β˜…β˜… Β· #1560 Β· β—ˆ6 Β· JoJo's Bizarre Adventure: Stardust Crusaders Β· Jojo
πŸ’€ vjsq9pf Β· β˜…β˜…β˜…β˜… Β· #4192 Β· β—ˆ4 Β· Punishing Gray Raven Β· XXI

molten glen
#

My!work

clear cryptBOT
#
glass.spells

You discovered a rare spellbook in *Black Clover*, selling it for zenis to a wizard in the Clover Kingdom.
Work +10 Zeni
<@&580565140420821013> +10 Zeni

molten glen
#

Owo

#

Wh

hexed forumBOT
#

🌱 | π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡, hunt is empowered by egem1[55/75] lgem3[328/800] !
blank | You found: :bee: :beetle: :beetle: :beetle: :bug: :bug: :butterfly: :snail: :snail: :chipmunk: :rooster: :pig2:
blank | 2025feb_laki dboar 2025feb_jose gained 49xp!

molten glen
#

Wb

hexed forumBOT
#
π•­π–Šπ–Šπ–‘π–Ÿπ–Šπ–‡π–šπ–‡ goes into battle!
beelz

L. 25 2025feb_laki - mythicmorbemrlsnail
L. 25 dboar - mythicpmrstaffepr
L. 26 2025feb_jose - mythicmshieldmwgen

Enemy team

L. 17 :rabbit2: - no weapon
L. 17 :chipmunk: - no weapon
L. 17 :sheep: - no weapon

molten glen
#

T!checklist

heavy pewterBOT
#
Daily Checklist
Reputation

no Reputation Given

Dailies

no Dailies Claimed

Quests

no Quest Bonus Claimed

Field Trips

5 / 5 Available Slots
0 / 5 Done!

Votes
<a:vote_topgg_incomplete:734500100730126386> **Vote Available**
<a:vote_topgg_incomplete:734500100730126386> **Vote Available**
#
<a:vote_topgg_incomplete:734500100730126386> You have `2` votes available! **Type `t!vote` for more details.**

Earn rewards by voting for Tatsu!
dice Voting Rewards Progress:
03/04 votes <a:e:734440988847767662><a:e:734440988407234630><a:e:734440988407234630><a:e:734440988407234630><a:e:734440988407234630><:e:734441009819287672><:e:734441009349656617> <a:e:706219192923455549> 1500 Credits
25/60 votes progress_bar_left_emeraldprogress_bar_middle_emeraldprogress_bar_middle_emerald<:e:734441009819287672><:e:734441009819287672><:e:734441009819287672><:e:734441009349656617> <a:e:946334062870671380> 1x Green Alien Eyes
vote_topgg_incomplete Voting Streak Buff: Tier 12

molten glen
#

T!daily

heavy pewterBOT
#

Claiming dailies β€’ [ glass.spells ] β€’ 2dice

Claimed Daily!

<a:e:706219192923455549> +200 credits @molten glen
<a:e:706219192713740390> - tokens@molten glen

    **Vote Reward Bonuses!**

<a:e:706219192923455549>+200 credits @molten glen
<a:e:706219192713740390>+25 tokens @molten glen

    You have ![dice](https://cdn.discordapp.com/emojis/745507698447220848.webp?size=128 "dice") `2` activity rewards

Use t!mail to view your mail or activity rewards.

    ** Current Streak ** 
**`4`** more claims to bonus!
molten glen
#

T!rep @tidal merlin

heavy pewterBOT
#

Reputation_Icon glass.spells has given @tidal merlin a reputation point!

molten glen
#

T!quest

heavy pewterBOT
#

Viewing daily quests β€’ [ glass.spells ] β€’ 2dice

Daily Quests

Today's daily quests refresh at <t:1741996800:t>.
Completing 4 daily quests will give you bonus <a:e:706219192713740390> tokens!
Maintaining a voting streak can increase your quest rewards!

You have unclaimed rewards! Type t!quest claim or click on the button below to redeem them!

Completion Status

Play Slots 15 Times

slots_used_incomplete <:e:734441009639063694><:e:734441009819287672><:e:734441009819287672><:e:734441009819287672><:e:734441009819287672><:e:734441009819287672><:e:734441009819287672><:e:734441009349656617> 0/15
Rewards: <a:e:706219192923455549> 252 credits
β€Ž

Catch 3 Fish

fish_caught_incomplete <:e:734441009639063694><:e:734441009819287672><:e:734441009819287672><:e:734441009819287672><:e:734441009819287672><:e:734441009819287672><:e:734441009819287672><:e:734441009349656617> 0/3
Rewards: <a:e:706219192923455549> 264 credits
β€Ž

Earn 79 Credits

credits_earned_incomplete <a:e:734440989636165673><a:e:734440988214558763><a:e:734440988214558763><a:e:734440988214558763><a:e:734440988214558763><a:e:734440988214558763><a:e:734440988214558763><a:e:734440990345003011> 79/79
Rewards: <a:e:706219192923455549> 254 credits
β€Ž

Earn 116 Chat XP

xp_earned_incomplete <a:e:734440989636165673><:e:734441009819287672><:e:734441009819287672><:e:734441009819287672><:e:734441009819287672><:e:734441009819287672><:e:734441009819287672><:e:734441009349656617> 14/116
Rewards: <a:e:706219192923455549> 276 credits
β€Ž

Train Your Pet 7 Times

pet_trained_incomplete <:e:734441009639063694><:e:734441009819287672><:e:734441009819287672><:e:734441009819287672><:e:734441009819287672><:e:734441009819287672><:e:734441009819287672><:e:734441009349656617> 0/7
Rewards: <a:e:706219192923455549> 260 credits
β€Ž

molten glen
#

T!slots

heavy pewterBOT
#

[ <a:e:706541470915493980> l SLOTS ]

<a:e:708773651163381901> : <a:e:708773722928054434> : <a:e:706481418183770186>

<a:e:708773722928054434> : <a:e:706219192923455549> : <a:e:708773651163381901> <

<a:e:706897136322609302> : <a:e:708773651163381901> : <a:e:706481392749379594>

| : : : LOST : : : |

glass.spells used 1 credit(s) and lost everything.

molten glen
#

T!fishy

heavy pewterBOT
#

🎣 | glass.spells, you caught: 🐟! You paid πŸ’΄ 10 for casting.

minor siren
#

t!remind vote in 12h

heavy pewterBOT
#

⏰ | Got it! I'll remind you <t:1742043641:R>!

minor siren
#

wah

hexed forumBOT
#

ebot | BEEP BOOP. I AM BACK WITH 2880 ANIMALS,
blank | 60000 ESSENCE, AND 84000 EXPERIENCE
common | :snail:³⁴⁷ :bee:³³⁰ :beetle:³¹³ :butterfly:³⁡⁰ :bug:³⁡⁴
uncommon | :rabbit2:¹⁸⁷ :baby_chick:¹⁢² :mouse2:¹⁢³ :chipmunk:¹⁸⁸ :rooster:¹⁷³
rare | :cow2:⁰⁡⁴ :sheep:⁰⁡⁴ :dog2:⁰⁢³ :cat2:⁰⁴⁹ :pig2:⁰⁡²
epic | :whale:⁰⁰⁴ :penguin:⁰⁰⁷ :crocodile:⁰⁰⁷ :tiger2:⁰⁰⁷ :elephant:⁰¹¹
mythic | :ghost:⁰⁰¹ :dove:⁰⁰¹ :dragon:⁰⁰¹ :snowman2:⁰⁰¹
legendary | glion⁰⁰¹

minor siren
#

wah 12h

hexed forumBOT
#

ebot | BiteyAlmighty, Here is your password!
blank | Use the command owo autohunt 14400 {password}

minor siren
#

wah 12h sdjjs