hk-general

[frail shell]

meat

[proper ledge]

And you get the full hp before fight on absrad

[frail shell]

🗿

[analog elk]

yah

[strong relic]

no-

i havent even beaten it yet

[frail shell]

lowkey I agree to the conclusion of that agreement I agreed to agree with the agreement of agreeing to the agreement I agreed to

[strong relic]

Doesnt matter if i get touched by him 24/7

[ember fulcrum]

no like p1-p4 bindings

[strong relic]

Nope

I dont wanna suffer

lmao

[ember fulcrum]

theres a pretty big help if you get some

[proper ledge]

Its so cute

[strong relic]

Yea true

[strong relic]

😭

Hopefully I dont get touched too badly

[ember fulcrum]

if you get a certain amount, ||you can unlock lifeblood at EVERY bench||

[proper ledge]

I think its useless on him level

[strong relic]

Oh right...

[strong relic]

Nah Ima need it so i can play hyper aggro fr

[proper ledge]

You can and without it

Just dont take damage

[strong relic]

Yea ik

[strong relic]

bro might be onto smth lmao

[ember fulcrum]

i might needa try that one

[proper ledge]

If you wanna i can demonstrate the gp

[strong relic]

nah its alright

Lwk tho I should probably get all the charms

Im still missing a couple

[ember fulcrum]

which ones?

[proper ledge]

Which?

[strong relic]

Uhhh lemme get a pic

Hol on lemme boot up the game again

Im at 105% rn

[proper ledge]

Btw, can you show your build?

[strong relic]

You can see frm here lmao

I have fragile heart

but someone is keeping it hostage rn

[proper ledge]

Dont worry

You missed bad charms

[strong relic]

yea

Lwk tho should I go for my third container?

[proper ledge]

With nail-build no

You should start to use magic

It so cool ability

[strong relic]

Thats true

but i need to use ddive in some cases

[proper ledge]

*ddark

[strong relic]

Yea same thing 😭

[proper ledge]

No

[ember fulcrum]

ddark has more invincible frames right?

[strong relic]

Oh

[proper ledge]

ddive is white spell

ddark is black

[paper vapor]

no

[strong relic]

Wild

[ember fulcrum]

oh i thought it did

[strong relic]

Ima go slaughter some peeps for geo

[proper ledge]

Stop, are you havent got a ddark?!

[strong relic]

Nah i need my unbreakable heart

Wait lwk ima go check if i did the fountain or not

cause i dont think i did

[ember fulcrum]

dont waste your precious geo on that fountain

[strong relic]

Wild

[ember fulcrum]

Sly be like:

[sinful onyx]

Man, Dead Cells is so fun

[strong relic]

Alright ima go check if i have enough life blood to open the thing

in abyss

Oh nice i think i do

Oh i do

W

[ember fulcrum]

W

[strong relic]

Oh i got lifeblood core

Anddddd I cant reenter

[ember fulcrum]

oh yeah i probs should've warned you

[analog elk]

yeah I just softlocked my entire system by accidentally launching hollow knight twice

[strong relic]

Thoughts?

[undone chasm]

That is a build that is good if you know how to abuse flukenest, bad if not

[strong relic]

Lol

[analog elk]

how do you abuse it?

[strong relic]

hitbox lingering

[undone chasm]

Idk speedrunners have a magic trick I don't understand

[ember fulcrum]

yeah, if you spam them with good timing you can almost 1 shot MMC

its wild

[strong relic]

Nah basically the hitboxes of flukes linger for a bit even after it disappears which makes bosses take multi hits from one fluke which causes u to deal hundreds of dmg with one spell

[analog elk]

my favourite build is Shaman Stone, Quickslash, Unbreakable Strength, Steady Body and Nailmaster's Glory

[undone chasm]

Ah the meta build

[analog elk]

aha so you hit bosses into the hitboxes on the ground then

[strong relic]

Yea

And if they throw a tantrum

it makes the spell hit them multiple times

[analog elk]

well for the most part yeah.. some people really don't like to use steady body for some reason

[ember fulcrum]

i like holding forward

[analog elk]

sorry for the reply ping btw

[strong relic]

time to mow through p5 trust

[undone chasm]

You have been forgiven

[ember fulcrum]

overcharmed lifeblood is peak trust

[strong relic]

Real

[ember fulcrum]

better build is overcharmed Joni's × Hiveblood /j

[strong relic]

W p5 build?

[analog elk]

you might make the bosses die of cringe so yeah maybe

[midnight oasis]

Better than quickslash

[ember fulcrum]

compass is too strong theyll die too fast

[strong relic]

LMAO

[strong relic]

Yea mb

[strong relic]

😭 Why are there two diff lifeblood hearts...

[analog elk]

hiveblood things

[ember fulcrum]

the hexagons are the ones that get restored by hiveblood

[strong relic]

Alright and tehres four normal ones

[ember fulcrum]

the other ones didnt get the memo

[strong relic]

WILD

I might start running this

[ember fulcrum]

double damage bosses are your biggest op

[strong relic]

Yea

[ember fulcrum]

||do you only have 10 notches?||

[strong relic]

Yea

Btw if i kill her, does she respawn?

[ember fulcrum]

NOONONONO

[strong relic]

Im just asking

[ember fulcrum]

myla is sacred

[analog elk]

I think a very simple change that would have made hiveblood better is if when you healed, the progress on the mask that was being restored by hiveblood was carried over to the next one instead of restarting from an empty mask

[lyric niche]

free her from the radiance

kill

[midnight oasis]

Yes feel free to kill her as many times as you want

[strong relic]

Wild

[midnight oasis]

(No)

[strong relic]

I havent touched myla once

[strong relic]

Oh lmao

[lyric niche]

respawns if you start another save

[ember fulcrum]

that actually sounds awesome i wish that was real

[strong relic]

Oh

Man I love placing geo rocks here so all the geo falls into places you'll never be able to go

[ember fulcrum]

gathering swarm for the win

[strong relic]

Lmao

btw how do u get the other crystal peaks charm?

the one that slows healing but heals double

[ember fulcrum]

i honeslty dont remember

[strong relic]

Wild

[ember fulcrum]

i could go open my game and check my map

[strong relic]

😭

[ember fulcrum]

nintendo switch takes a bit to load

[strong relic]

Bro

I went into crystalized mound

and figured there was nothing there

did the parkour again

only to get to the end and be like "Hey i wonder whats down there" And jump down

😭

[ember fulcrum]

oh no

[lyric niche]

theres a breakable wall in a room

[strong relic]

Oh

Ofc there is

its always the breakable walls...

[lyric niche]

literally the best spell 🥀

[strong relic]

Oh right

[ember fulcrum]

its a room with alot of lazer guys

[willow wraith]

man i so hate deepnest

[strong relic]

NAH THATS SO REAL

[strong relic]

alr ty

[ember fulcrum]

I JUST DIED OH NO MY 20000 GEOO

I GOTTA GET IT BACK

[glass crag]

silksomg when?

[ember fulcrum]

in a few hundred years

[strong relic]

Wild

[strong relic]

just go to the guy

the shaman

or wtb

wtv

[ember fulcrum]

i forgot they existed

but i did get the lil rascal back

did you find the charm?

[strong relic]

Nope

[ember fulcrum]

would you like a screenshot?

[strong relic]

Oh nah its fine I just pulled up a map lmao

[ember fulcrum]

aight cool

[strong relic]

alright finna got it

I would go for waver song

but spiders

[ember fulcrum]

they are scary

but the lil guys are super cute

[strong relic]

Lol

What is shape of unn again?

[ember fulcrum]

slug healing

[strong relic]

Oh

Oh nah i dont think I have that...

Welp

[ember fulcrum]

its easy to get

[strong relic]

Yea ik

just a cdash away

Finally broke this wall lmao

[ember fulcrum]

oh wow

free money

[strong relic]

Yuh

Welp i got it

Outta there

Just two more to go

Well one of em is weaversong

[ember fulcrum]

you gotta face the spideys

[strong relic]

Oh wait

I need carefree melody

[ember fulcrum]

you cant get that one

[strong relic]

Oh

I need to banish em

Rip

[ember fulcrum]

you beat NKG alreafy right?

[strong relic]

Yea

I got the useless ahh kid

Can i sell em lmao

[ember fulcrum]

i like grimmchild

[strong relic]

Idk what my last charm is

[ember fulcrum]

nope your stuck with having a minion build

[strong relic]

Lol

Oh wait

Idont think I have glowing womb

[ember fulcrum]

it looks like you dont have Glowing Womb

[strong relic]

Oh...

[ember fulcrum]

do you know where it is?

[strong relic]

Btw is it possible to infect crossroads before the map guy leaves?

[strong relic]

Yea (I dont pay attention to the walls)

[ember fulcrum]

i think he leaves after you get to the next new area

so probably not

[strong relic]

Oh

Whats the "next area" tho

[ember fulcrum]

probs any new area for you atp

have you been to every area?

[strong relic]

Oh

Yea

[ember fulcrum]

yeah if you check Iselda's shop in Dirtmouth you should see any maps you may have missed

[strong relic]

Welp just got glowing womb

[strong relic]

Nah I've bought everything already lmao

[ember fulcrum]

hooray

ah aight

[strong relic]

Time for weaversong

Is it behind an unbreakable wall?

[ember fulcrum]

once again i dont remember sorry

[strong relic]

Its fine

no worries

Oops i was swinging my nail and scared someone off...

(never been here before)

[green cipher]

UGH

I hate these dumb mantises

[lyric niche]

breakable* but yeah

[green cipher]

And why are there so little benches

[strong relic]

They aint that bad

[strong relic]

Theres like two there

[green cipher]

Yeah but I’m at 1 health from falling in the water vs 3 flying mantises and 1 mantis

Like bro

I just lost a good amount of geo

Rahhhhgsskcgvju,fdscg,hkydsnifidnhsksnikinskinsksnkknkskkgnskmhgsnkhnsgkhgsnkfhgsnkvg5kvejkuv,,k,k,j,j,,j,,ig

I died there a couple times

[ember fulcrum]

its a hard game

[green cipher]

[strong relic]

Lmao

[strong relic]

You get better as you play more

[green cipher]

Uhhhhhhhh

I already spent 2 hours today

30 minutes was dying in the fungus jungle

[strong relic]

😭

Alright I finally got every single charm...

[green cipher]

[ember fulcrum]

yippee!!!

[strong relic]

u got thisss

[ember fulcrum]

hooray!!

[green cipher]

Ok thanks

What’s the bottom right one

[strong relic]

Uhhhh

[green cipher]

Ok ok I got this

[strong relic]

you'll know when the time comes

[green cipher]

I just have to destroy everything and have skill

Alright

Speedrun

[strong relic]

Should I break up bretta and zote?

Just for the funny

[ember fulcrum]

yyou might wanna spoiler this

[strong relic]

Oh yea mb

[ember fulcrum]

sure its a good prank

[strong relic]

Lwk a bit too late now

😭

[strong relic]

Alright

[green cipher]

But I could just search the bottom left charm

Right

[ember fulcrum]

well if other ppl come in here they might get spoiled

[strong relic]

Better not to

[green cipher]

Isn’t that like Grimm

[strong relic]

Ima just delete it (you cant mark smth as a spoiler after you've sent it)

[ember fulcrum]

ohhh

[strong relic]

At least not pictures

Or maybe idk how

[ember fulcrum]

didnt know that

[strong relic]

Yuh

Thats why i said too late now

Lmao

[green cipher]

Ok

Halfway there 💪

[ember fulcrum]

you got this!

[green cipher]

Ok

Ok

[strong relic]

I love it when bretta falls over and flails her legs lmao

Time for the third time

[strong relic]

u got thisss

[ember fulcrum]

but this game is a masterpiece and better explored without spoilers

[green cipher]

Yessirr

[humble pulsar]

@alpine atlas are you talking about this guy?

[strong relic]

WWW

[alpine atlas]

Bro

[green cipher]

Alright all right

[alpine atlas]

Ofc not

[green cipher]

Now to heal this weird bug thing

[alpine atlas]

That is gurgly

[green cipher]

Or smth

[alpine atlas]

Not gurglee

[humble pulsar]

It's Gurglee

I checked

[green cipher]

Aw I can’t reach it it’s behind a wall

[alpine atlas]

No baby in a blender is gurglee

[humble pulsar]

Wtf, baby in a blender

[green cipher]

What’s a dash master

[alpine atlas]

Don't worry it's dead

[strong relic]

Uhhh spoilers?

[green cipher]

I got it tho

It’s an emblem

Or charm

Yeah that’s it

[ember fulcrum]

those are huge spoilers

[strong relic]

@ember fulcrum YESSIR HES DELUSIONALLY BLABBERING NOW

[ember fulcrum]

YUHHH

i did the same

[strong relic]

Now do I wanna hate life

and do him 10x?

[ember fulcrum]

i havent even yet lol

[strong relic]

Lmao

I'll try 5 ig

[green cipher]

Do you get to fight zote

That’s his name right

[strong relic]

Ooops i got wrecked

[humble pulsar]

If you don't tell me who he is you might switch places, please just tell me

[strong relic]

Depends

thats all I can say

[green cipher]

Oh

[alpine atlas]

He is gurglee

[humble pulsar]

Gurglee needs to stop existing

I hate him her it whatever

[alpine atlas]

Gurglee my beloved

[strong relic]

Aaaaa

[green cipher]

What’s a gurgle

Is that a spoiler

[humble pulsar]

IDK

[strong relic]

If u really want answers/spoilers I can tell u in dms

[humble pulsar]

No

[green cipher]

I don’t. . . I just wanna know what a dans master is

Or what it does

[humble pulsar]

||Charm||

[midnight oasis]

WHAT

NO

[alpine atlas]

Gurglee*

[green cipher]

Gurglee

[humble pulsar]

Please tell me that's fanmade

[alpine atlas]

Pronounced gurgle lee

[midnight oasis]

WHYYY

[green cipher]

:0

[strong relic]

Oh you'll figure it out

[ember fulcrum]

its fanmade

[green cipher]

That old guy died?

[midnight oasis]

😭

[humble pulsar]

Good

[alpine atlas]

Yes his last words where truly inspiring

[strong relic]

Im struggling on 5 rn (I wonder why)

[midnight oasis]

unfortunately

[humble pulsar]

Why

[midnight oasis]

I dislike elderbug

[strong relic]

@ember fulcrum Just missing p5

[midnight oasis]

not too fond of him

[humble pulsar]

And now I dislike you

[alpine atlas]

P5 isn't a %

[ember fulcrum]

p5 isnt a percent (thankfully)

[strong relic]

Oh then idk what im missing then

[green cipher]

I got a mantis claw

[strong relic]

WWWW

[green cipher]

I think I can jump on walls

[midnight oasis]

Okay

[ember fulcrum]

have you looked at ||Colloseum of Fools||

[alpine atlas]

3rd colo?

[strong relic]

yea done all three

[ember fulcrum]

yuhhh!!

[alpine atlas]

Nkg/banishment?

[strong relic]

boss of third one is ||god tamer|| no?

[strong relic]

yea

[ember fulcrum]

oh wait you only have ||10 notches||

[alpine atlas]

Yes

[strong relic]

Oh wait im missing a notch...

[alpine atlas]

Isn't notch not %

[ember fulcrum]

i swore every notch was a %

[strong relic]

Every mask is

[alpine atlas]

Oh they are missing a vessel frag

[strong relic]

Thats all ik

[strong relic]

Oh wait

yea

[ember fulcrum]

OOHHHHH

[alpine atlas]

Cuz they got 2

[strong relic]

thats what

😭

[ember fulcrum]

yeah its that

[strong relic]

I really dont wanna figure out which piece im missing...

[ember fulcrum]

have funnnn

[strong relic]

Oh pretty sure im missing the one in that rlly high place

I'll go check ig

[alpine atlas]

When did u 112%

[ember fulcrum]

i got it about 80 hours in, im now at 135 hours in

(and i havent played in awhile)

[alpine atlas]

I cant make this up

I got it at 69 hrs and 35min

[ember fulcrum]

thats amazing

[green cipher]

Guys thanks for the motivation

[ember fulcrum]

ofc!!

[strong relic]

How do I get to the fragment above ||gorb||?

[alpine atlas]

You just do

[strong relic]

Wild

[ember fulcrum]

||unlock every stag|| is the real answer but its better if you figure it out yourself

[green cipher]

Guys

[strong relic]

Oh alright

Btw I do have every one of em

[green cipher]

The need to press those grey words is too powerful

[strong relic]

I think at least

[green cipher]

I’m not gay :((

[strong relic]

Lmao

[alpine atlas]

Leave then

[alpine atlas]

I know

[strong relic]

Lwk now that I see the list, I might be missing one...

Oh I am

[ember fulcrum]

yup

[alpine atlas]

Queens gardens

[ember fulcrum]

spoiler

[alpine atlas]

Isn't that only,hk help

[ember fulcrum]

idk im new

[lyric niche]

✅

[ember fulcrum]

oh ok

GPZ is messing me up

[strong relic]

Alright i got the last one...

Ohhhh

Thats interesting

[ember fulcrum]

im not the type to focus one boss for too long

[strong relic]

Its over...

[strong relic]

Same

[ember fulcrum]

oh no...

[balmy cargo]

can't relate i have to beat ||collector|| yesterday

[ember fulcrum]

oh jeez

[strong relic]

Oh wait

I think i never did fountain

so i only need one

[ember fulcrum]

oh cool

once again i have no clue where the last one is

[strong relic]

Lmao yea thats on me

[ember fulcrum]

i finished all that stuff a few years ago

(i took a big break until the start of the month)

[strong relic]

I mean even if u finished like yesterday all in one day, you still wouldnt know which ones I havent gotten yet

😭

[ember fulcrum]

true

[strong relic]

I feel so abnormally fast 😭

[ember fulcrum]

yeah its really fun

dashmaster and sprintmaster ccombo into each other

[strong relic]

Lol

[scarlet needle]

Definitely will make you fast but uh…why is there compass and greed?

[ember fulcrum]

compass is overpowered

[scarlet needle]

Only for knowing where you are lol

[strong relic]

To not get lost and greed to get more geo for fountain

[ember fulcrum]

it also insta kills every boss

[scarlet needle]

[strong relic]

Without compass, no boss where know where they should be

[scarlet needle]

Lol

[ember fulcrum]

trueee

[strong relic]

Ok i found the last fragment

just gotta grind geo now.

Ofc the fragment was in deepnest tho

[ember fulcrum]

ohhhhh that one

[strong relic]

Yea

Oh

I just accidentally talked to elderbug..

(this is the first time I talked to him)

[ember fulcrum]

youve been ignoring him this long?

[strong relic]

Yea lmao

[ember fulcrum]

poor dude

[strong relic]

Real

Yesss i have enough

WWWW

[ember fulcrum]

YAYYYY

[strong relic]

finally

Now gotta play omori

💔

[ember fulcrum]

lol

[strong relic]

Lwk I wish I had more friends who were willing to watch me play games

[humble pulsar]

Is Omori worth it?

[strong relic]

Never tried it

But everyone who talked abt it gave it good reviews

[ember fulcrum]

omori is very hard on me mentally lol

but is amazing

[strong relic]

lol

[humble pulsar]

Oh ok

[strong relic]

Ima ask ya for tips if i get lost

if u dont mind ofc

[ember fulcrum]

i havent finished it but ive watched a full playthrough

[strong relic]

Oh lmao

[humble pulsar]

The it's going on my "Games to play" list

[strong relic]

Lmao

[ember fulcrum]

i just realized i cant post images

probs cuz im new

[strong relic]

Rip

What u tryna post?

[ember fulcrum]

well i realized when i was gonna try giving screenshots

[strong relic]

😭

What u tryna post tho

[ember fulcrum]

i also cant post images in the art gallery 💔

hk art

[strong relic]

Oh

u can dm me it and i can send it for u

[ember fulcrum]

nah im sure itll let me art eventually

[strong relic]

alr

[waxen jungle]

Past-perfect tense grammatical clauses in big April 💔 we on time is immaterial and our motion through it needs not be a fixed march forwards

[ember fulcrum]

hm?

[grizzled vector]

Shaw + Skong = Shong

Silkshong

That's how Sean Connery pronounces Silksong

Shilkshong

Huh

Neat

[flint badger]

If I buy the game on Steam, will the DLCs come with it? And will the Silksong DLC ​​come for free as well?

[grizzled vector]

Silksong isn't a dlc

It's the second game

[strong relic]

Yes you get all the DLCs. No Silksong is the sequel to Hollow Knight and will be a seperate game

[brave blaze]

[ember fulcrum]

[flint badger]

tysm

[ivory ore]

[strong relic]

Np

[white ermine]

wait

what

[strong relic]

?

[white ermine]

was it really the only thing missing for the 112% ?*

[strong relic]

yea

I just missed a soul canister

[white ermine]

damn

the parcours one ?

[strong relic]

Why?

Mmmm not really

Are u trying to get help?

[white ermine]

nah it's nothing, just for me (it's weird) the pantheon were the last % that everyone makes in last

[strong relic]

Oh lol

I just didnt pay much attention to unbreakable walls and stuff

[ember fulcrum]

i think my last one was the last Colosseum trial

[white ermine]

the pantheon is maybe the last thing I discovered

like after grimm

after 70 Hours on the game

[strong relic]

Lol

[desert glen]

I finally joined the hollow knight discord hello only took 3 years

[strong relic]

Lmao

[desert glen]

got all achievements I'm guessing everyone else has as well do you guys think silk song will actually get released this year or get delayed

[strong relic]

Probs will get released this year

[ember fulcrum]

i havent every achievement

but i do think its this year

[white ermine]

this year

[marble sequoia]

Hornet canonically does drugs

[brave blaze]

Sa

[kindred basin]

First we silk, then we song

[ember fulcrum]

lifeblood?

[marble sequoia]

Yeah

It's technically voodo

[ember fulcrum]

oh true

[marble sequoia]

But it would still classify as a drug

[ember fulcrum]

especially how she looks to be administering it in Silksong

[marble sequoia]

Yes

But the true question is whether she is an addict or not

[ember fulcrum]

she seems stable enough

[marble sequoia]

True

[ember fulcrum]

also kirbo from terminal?

[ivory ore]

as

[marble sequoia]

I guess lifeblood just isn't addictive

[marble sequoia]

What what

[ember fulcrum]

terminalmontage kirbo

[ember fulcrum]

or hornet is just really strong

[marble sequoia]

Yeah but how does that fit into drugs

[marble sequoia]

Yeah

[ember fulcrum]

sorry i just saw your pfp

[marble sequoia]

Oh yeah

Ok so wait but the knight also takes lifeblood (be it in a more raw form)

[ember fulcrum]

yeah but ||no mind to think|| no addiction to have

[marble sequoia]

True

The thing is though, the knight is void

So no circulatory system

That would mean the lifeblood is never properly administered

[ember fulcrum]

it could go into the shell through the eye holes?

[marble sequoia]

Oh you know what i think it's the reason that the knight doesn't use a needle

Needles just don't work on the knight

[ember fulcrum]

that would make sense

although im pretty sure they do have some form of ||innards||

[marble sequoia]

How though?

The vessels are supposed to be pure void

[ember fulcrum]

||THK boss and them stabbing themselves||

you can see stuff in there

and come out of there

[marble sequoia]

Right but that's just void leaking out

Since THK stabbed itself it no longer retains good form

So I'm pretty sure that vessels don't have innards

[ember fulcrum]

hmm fair

[strong relic]

They do

[ember fulcrum]

||well infection also leaked out||

[strong relic]

You can die to hornet can bro uses a needle

[marble sequoia]

I'm mean surgical needles

[strong relic]

Oh

[marble sequoia]

That's because THK was containing the radience

[midnight oasis]

nah they ain't

[strong relic]

Maybe the hollow knight breifly gained conciousness

[ember fulcrum]

yeah but it means they can hold stuff, no?

[midnight oasis]

You can see tendony things and stuff in THK during the opening cutscene

[marble sequoia]

Wait what

Those are void tendrils

[midnight oasis]

No?

[strong relic]

They're made of void

but not pure void

[marble sequoia]

Wait hold on

[midnight oasis]

Void tendrils are barbed

They have innards but they are made entirely of void

Void innards basically

[marble sequoia]

Wait I can't find a video of the opening cutsene

Could you send one

[midnight oasis]

https://www.youtube.com/watch?v=5rgw9mL2OOw

[strong relic]

Huh

Oh that

[marble sequoia]

Oh

But you still can't be sure they are tendons

It could just be the void inside THK ripping apart

[strong relic]

Lwk what if the vessels were woven together by the pale king and white lady

[marble sequoia]

From the radiance

[marble sequoia]

Not what happened but that would be cool

[ember fulcrum]

the vessels are their kids

[strong relic]

I mean silksong tho

[marble sequoia]

Like yoshis crafted world but darker

[strong relic]

Ik

[ember fulcrum]

oh jeez

[strong relic]

Damn now I wonder how many kids they had

Cause abyss

[ember fulcrum]

theres a video on that by Ccmaci

[marble sequoia]

I mean you could count how many skull sprites there were to get a baseline

[strong relic]

Whatd they say?

[strong relic]

They been busy at it fr 😭

[marble sequoia]

But there would probably be more skulls underneath

[ember fulcrum]

theres multiple answers

[ember fulcrum]

||birthplace||

[marble sequoia]

Yeah but there are more places other than that

[strong relic]

I mean the skulls are probably stacked on top of each other to make abyss

[marble sequoia]

We don't know how big the abyss cavern really is

[strong relic]

and we dont rlly know the exact area

so yk

[marble sequoia]

Yeah

[ember fulcrum]

well we know they came from eggs

[marble sequoia]

True

Also, how many vessels per egg?

[ember fulcrum]

yeah exactly

thats the unknown part (im pretty sure)

[marble sequoia]

Cause there were a lot of vessels and we don't see that many eggs

[ember fulcrum]

the vessels could be layered over some hidden eggs

[marble sequoia]

True

I know this is going to be a stupid theory but what if the eggs were like little vessels factories

[strong relic]

Would ddive/ddark break the eggs?

[marble sequoia]

They just make them one at a time

[ember fulcrum]

the biggest estimate was around a million tho

[strong relic]

so like those two were producing producers to produce vessels

[ember fulcrum]

that doesnt seem right

[marble sequoia]

Oh wait that's also true but I meant every egg just kept making vessels

[marble sequoia]

Yeah but like vessels factory

[ember fulcrum]

im pretty sure the vessels were originally living bugs until the void seeped in

[marble sequoia]

Yeah

But that happened before they were born

[ember fulcrum]

yeah but that means they are most likely biologically created

[strong relic]

But arent they born from the two?

[marble sequoia]

Technically they were most likely existing, but not technically alive when the void seeped in

[ember fulcrum]

yeah but like if they hatched somewhere else they wouldve been living yknow

[marble sequoia]

Yes

Or not

[strong relic]

Are there any more vessels?

[marble sequoia]

It has been proven that void can infect living creatures

It just kills them in the process

[ember fulcrum]

yeah

[strong relic]

I mean yea ending 4 and 5 is the best example of that

[marble sequoia]

Yeah, but they are mostly dead

[strong relic]

Honestly tho

[ember fulcrum]

also the collectors lover

[marble sequoia]

Oh yeah

[strong relic]

Did void rlly infect them or was void just overflowing from them cause the shade king was in their dreams

and their dream couldnt handle it anymore

[marble sequoia]

Shade king is not a dream god tho

The radiance is

[strong relic]

Oh right

but i mean you are the shade king

[brave blaze]

@packgod roast this guy

[marble sequoia]

Also all dead void infected people we have seen have come into prolonged contact with void

[ember fulcrum]

yeah

[strong relic]

The sentence didnt make sense to me

😭

[marble sequoia]

Void infected bugs that are dead have always spent a while near void

[ember fulcrum]

which also makes me wonder how White Lady doesn't get hurt because she definitely handled PV for some time

[strong relic]

Eh Ig

[marble sequoia]

Like the collectors lover, lighthouse keeper, or the pale king

[strong relic]

So like

you're a mini radiance

[ember fulcrum]

the void seems to have a mind of its own until it goes into a vessel

[marble sequoia]

Not really

[strong relic]

Oh

[marble sequoia]

Vessels are trained to be empty

[eager hazel]

hey everyone

[ember fulcrum]

why else would the ||void attack radiance on its own?||

[ember fulcrum]

sup

[marble sequoia]

It's a hive mind

[strong relic]

My brain isnt braining anymore

[ember fulcrum]

oh i see

[strong relic]

We're lwk hella off-topic rn

[marble sequoia]

Yeah

[humble pulsar]

This is the offtopic channel

[marble sequoia]

We started with drugs

[strong relic]

They are required to be empty to contain the radiance which thk wasnt

[ember fulcrum]

what were we first talking about?

oh

[strong relic]

Wild

[ember fulcrum]

yeah in my head i thought they were just no brain to begin with (The Knight didnt get trained)

[strong relic]

Yea I mean they dont

[marble sequoia]

That was because THK loved its father (honestly, bad choice)

[strong relic]

Pretty sure vessels dont receive training

They're not supposed to

[ember fulcrum]

well training is how THK got so big

[marble sequoia]

THK did

[humble pulsar]

Wait what is Hornet then?

[marble sequoia]

Yeah

[ember fulcrum]

not void

[humble pulsar]

Because she isnt a vessel

[marble sequoia]

The gendered child

Hornet is not void

[strong relic]

But spending long periods of time with someone would get you attached to them

[ember fulcrum]

shes like me fr

[ember fulcrum]

L on their part

[strong relic]

THK wasnt pure because it sepnt too long with its dad (PoP)

[marble sequoia]

Hornet was a result of hera wanting a child in return for being a dreamer

[strong relic]

Herrah rlly wanted em fr

[ember fulcrum]

and she was never in the abyss as an egg, and therefore has no relation to the void

[marble sequoia]

I mean technically the void is her half sibling

[strong relic]

She has like millions of step bros

😭

[ember fulcrum]

well step siblings

[strong relic]

Yea

[marble sequoia]

Wait why

[ember fulcrum]

the vessels have no gender

[strong relic]

How many kids are in the abyss

[marble sequoia]

Millions

[strong relic]

Probably millions

Exactly

[marble sequoia]

Yes

[strong relic]

So she has millions of step siblings

[marble sequoia]

But why step siblings

[ember fulcrum]

a million was the highest guest in the ccmaci vid

[strong relic]

Same father diff mother

[ember fulcrum]

different mother

[marble sequoia]

It's half sibling

[strong relic]

Yea

[marble sequoia]

That's the correct term

[ember fulcrum]

wait

[strong relic]

Oh

Right

Yea

[ember fulcrum]

yeah sorry english

[marble sequoia]

Step sibling is adopted sibling

[strong relic]

My english not englishing

My brain fried rn

[marble sequoia]

Understandable

[ember fulcrum]

im tryna do this banter while figghting GPZ

[strong relic]

Second day of my spring break and my brain still aint recovered from school 💔

[strong relic]

How many adjectives?

[humble pulsar]

Herrah?

The beast

[marble sequoia]

Yeah

[ember fulcrum]

off the screen at this point

[strong relic]

Yea

[strong relic]

Lmao

[humble pulsar]

And pale king, so how many women did pale king get children with?

[ember fulcrum]

2

[marble sequoia]

I've been pacing so long it's taking a toll on my mental capacity 😑

[humble pulsar]

I think PK just has rizz then

[ember fulcrum]

you pace while talking?

[marble sequoia]

I guess

[strong relic]

like 2 so far?

[marble sequoia]

Yes

[ember fulcrum]

PK did the herrah thing for a deal

[humble pulsar]

What deal

[marble sequoia]

Yeah but he still did it

[ember fulcrum]

so Herrah will be a dreamer

[strong relic]

She be dreamer for uhhh intimate stuff with pk

[marble sequoia]

Herrah wanted a child in return for being a dreamer

[ember fulcrum]

im pretty sure she specifically wanted the kid

[humble pulsar]

So how did monomon and lurien become dreamers?

[strong relic]

Yea

[marble sequoia]

Yes

[strong relic]

They agreed to be one

[marble sequoia]

Lurien was a simp

[strong relic]

Lmao

[ember fulcrum]

i think lurien was devoted and monomon i have no clue

[marble sequoia]

And monomon thought the plan sucked but did it anyways

[ember fulcrum]

yeah ig

[midnight oasis]

Monomon offered herself up

According to Quirrel

[strong relic]

Yea

[humble pulsar]

So monomon is just kinda dumb

[midnight oasis]

Only after it failed

[marble sequoia]

Wait what

[ember fulcrum]

she is the teacher tho

[midnight oasis]

Why would she do it if she knew it was futile

[strong relic]

Worth a shot

[marble sequoia]

True, she was actually very tactically intelligent

[midnight oasis]

Reread what I said

[humble pulsar]

Also, why don't the dreamers fight back?

[marble sequoia]

Wdym

[ember fulcrum]

they aint supposed to

[midnight oasis]

heck are they gonna do

[strong relic]

Yea

[marble sequoia]

They can't they are just seals

[midnight oasis]

All 3 dreamers combined only mustered an essence blast that knocked the knight on the floor for like 2 seconds

[strong relic]

They've spent years doing nothing

[marble sequoia]

It's THK that has to fight

[humble pulsar]

And he still lost

[strong relic]

Well thk isnt rlly a dreamer

[marble sequoia]

Cause of the power of love

[strong relic]

Maybe after stepping on you once or twice

[strong relic]

We fighting over whos our parents fav child fr

[humble pulsar]

Yeah ok

Does respawning have anything lore related?

[marble sequoia]

No, the love that THK had for its father

[midnight oasis]

no

No other vessels respawn

[marble sequoia]

It doomed the kingdom

[midnight oasis]

Source

[strong relic]

So he lost cause he loved his father?

[ember fulcrum]

yup

[marble sequoia]

Yeah but like what if they have the ability, but they just can't find their body among all the other corpses

[strong relic]

And you won cause u didnt love your father?

[undone chasm]

Or the plan was doomed from the start and this was just how it showed

[humble pulsar]

In the game, no

[humble pulsar]

U are hollow

[undone chasm]

Did we win

[ember fulcrum]

no mind to love father

[midnight oasis]

A) What about the vessels outside of the abyss
B) What are you even saying

[strong relic]

Ok so you won cause you dont love?

My brain is confusion

[humble pulsar]

Yep

[strong relic]

That makes no sense

😭

[humble pulsar]

You need to be completely hollow to contain the infection, if the infection comes out it will doom hallownest

[ember fulcrum]

the knight we play as has no mind to think and therefore has no opinions on PK

[midnight oasis]

Source

[strong relic]

Yea and thats why he won?

[marble sequoia]

Their respaw point is inside the abyss

And they can't get out cause the door is closed

[ember fulcrum]

more of a tie

[midnight oasis]

Multiple vessels left the abyss

[strong relic]

Wait now my brain is confusion

so thk lost against you cause you have no mind

[midnight oasis]

TK is not a pure vessel

TK has a mind you enter it

[marble sequoia]

What

[humble pulsar]

So the more brainless you are, the stronger you are

[marble sequoia]

The knight?

[undone chasm]

Voidheart memory

[marble sequoia]

The one you play as?

Oh

[ember fulcrum]

thats more being the radiance's domain

[strong relic]

but the radiance has a mind and bros strong

[marble sequoia]

But that's technically the memory of the egg

[midnight oasis]

https://youtu.be/OUJcGWoN5kU

[midnight oasis]

No?

Why would an egg have a memory of the knight

[ember fulcrum]

the radiance is the one mind controlling

[humble pulsar]

She aint a vessel, she is a god

[midnight oasis]

You are dreamnailing your reflection

[marble sequoia]

You enter the mind of the egg because that's what you dreamnail

[ember fulcrum]

the egg has a reflection of the knight

[strong relic]

Wait so the only reason why you won against thk is cause u lack a brain? 😭

[undone chasm]

Glad that the egg that was stationary and contained 5 million vessels remembered just our part

[marble sequoia]

There weren't that many vessels

[midnight oasis]

You dreamnail a reflection of the knight

[undone chasm]

Not the point

[humble pulsar]

Oh wait, do you see your memories?

[midnight oasis]

It is quite literally a memory of the knight if it was the eggs memory it wouldn't follow the knight

[marble sequoia]

Maybe that was specifically the knights egg

[ember fulcrum]

most likely

[midnight oasis]

It was yes

[marble sequoia]

We don't know how many vessels there were per egg

[midnight oasis]

Its still the knight's memory

[strong relic]

I think Kirbo was referring to smth different from what I was thinking

[undone chasm]

With how many vessels there are in comparison to eggs would there really be only 1 vessel per egg

[marble sequoia]

How

[tough nova]

why aint the knight as old as THK

[marble sequoia]

We are

[undone chasm]

They are

[marble sequoia]

They are just bigger

[humble pulsar]

But you are in a memory, how does the knight look back at you if you werent there originally

[marble sequoia]

Because of training

[tough nova]

but thk bihher

[ember fulcrum]

they only got bigger cuz of training

[marble sequoia]

Training

[undone chasm]

The knight looking back is thk

[strong relic]

But like if u were born earlier and a better fit to be vessel, why werent u chosen?

[undone chasm]

Look at the horns

[ember fulcrum]

thk got there first

[humble pulsar]

Ohhhhh, i thought it was the knight, but still, the knight wasnt there right?

[marble sequoia]

Not fast enough

[undone chasm]

Pk is kinda stupid (or we were both not a good fit)

[strong relic]

So it is older than you or what?

[ember fulcrum]

most likely the same age

[marble sequoia]

No, THK was just faster

[midnight oasis]

Have you gotten void heart

[undone chasm]

Yes it was, it's a memory

[midnight oasis]

The memory literally follows the knight

[humble pulsar]

Ohh, wait yeah nvm

[strong relic]

And pk said "yea ok lets stick with the flawed vessel so we can use the purer one later"?

[marble sequoia]

Yes

[ember fulcrum]

only flawed because of the relationship they had

[strong relic]

Yea ig

[midnight oasis]

This isn't true though

[marble sequoia]

How

[strong relic]

Did u do PoP?

[midnight oasis]

White Lady says its supposed strength was ill judged therefore it was never pure

[midnight oasis]

Yes and there is nothing related to purity in there

[marble sequoia]

Emotional strength

[strong relic]

It had a feeling towards its father

[marble sequoia]

Yeah

[strong relic]

Which made it infectable

[midnight oasis]

No one is disputing that

[marble sequoia]

There are still dream nail violates in the game for THK

[midnight oasis]

Where are you getting this from

[marble sequoia]

The game

[strong relic]

Pk made the vessels out of void for a reason

Vessels of void has no mind

therefore they cant be infected by the radiance

[midnight oasis]

You do realize that the plan did not work right

[strong relic]

Yes because the thk was not pure

it got a mind after it got feelings for its father

[midnight oasis]

And there's no reason to think it was ever pure

[strong relic]

Well not that kind of feeling

[midnight oasis]

The exact opposite is stated in fact

[strong relic]

so bro used flawed void to make the vessel and said "yea that'll work"?

[midnight oasis]

Yes.

[strong relic]

😭

[midnight oasis]

It was a last resort

[marble sequoia]

No

[strong relic]

Theres no way

[marble sequoia]

Pk didn't know thai THK wasn't hollow

[sterile plover]

Dream Nail: Fungal Wastes - Giant Mushroom - "Pale Wyrm... What good to foresee a demise unavoidable?"

Pale Wyrm... What good to foresee a demise unavoidable?

@starpengu used /dream-nail area: Fungal Wastes name: Giant Mushroom - "Pale Wyrm... What good to foresee a demise unavoidable?"

[strong relic]

Why didnt pk use vessels who were made from unflawed void then?

Is flawed void even a thing

[marble sequoia]

This means that big fungus didn't believe in pk's plan

[midnight oasis]

No

[strong relic]

Yea so bro was mindless

at the start

[tough nova]

no he knew it wouldn't work

[midnight oasis]

Also PK didn't choose what void made its way into the vessel

[strong relic]

Void is void tho

[midnight oasis]

Yes

[strong relic]

theres no different type of void

[midnight oasis]

Which means what you are saying is nonsense

[strong relic]

??

[midnight oasis]

If there aren't different types of the void the question of "Why didnt pk use vessels who were made from unflawed void then?" makes no sense

[strong relic]

Ok so like you're saying that thk didnt work cause it was made of void but other vessels made of the same void would work but pk said "ykw Ion wanna deal w this"?

[strong relic]

Cause ur saying bro was flawed from the beginning

[midnight oasis]

No vessel would've worked

The plan was just doomed

[strong relic]

no just the one they chose wouldnt have worked

[midnight oasis]

Its not like they had a way to tell if it would've worked or not

[strong relic]

Well yea so pk didnt know that thk grew a mind

[midnight oasis]

Until THK failed anyway

[strong relic]

Well pk was long dead by then

So bro wouldnt have known either way

[undone chasm]

Was that so

[midnight oasis]

No?

[undone chasm]

Wouldn't pk have died because thk failed

Or well, because the kingdom failed

[midnight oasis]

yes

[strong relic]

When did pk die then

[midnight oasis]

After the kingdom died probably

Idk why he'd dip while the kingdom was perfectly fine

[strong relic]

Wait

[undone chasm]

Waiting

[strong relic]

so first off during the beginning cutscene

the infection leaks out from the black egg temple

isnt that supposedly when the kingdom starts failing?

[midnight oasis]

No

[strong relic]

Then when did it fail

[midnight oasis]

Long ago

[strong relic]

And why did it fail?