sk-discussion

[marsh ibex]

Yeah but we keep forgetting

[chrome basalt]

Many such cases

[tidal axle]

RAHHHHHH 19 HOURS LEFT

[violet path]

Whats with the new server pic

[full rune]

until what

[fiery burrow]

I start throwing hammers at you

[chrome basalt]

This has literally always been the server icon, why do people keep saying this

[dense temple]

in april fools 2024 mods were doing furry rp if i remember correctly

[violet path]

Omg go tell her how you feel

[patent knot]

Until the second day of the month of course!

[marsh ibex]

happened like an hour ago and I still feel agony

[sinful flare]

now theyre doing it FOR REAL

[dense temple]

🤯

[sinful flare]

unfortunately there are no mods

[full rune]

wdym?

[violet path]

Oh

Sorry i get confused

[dreamy tulip]

silksong has become the april fools joke

[marsh ibex]

bro don’t leak ban appeals

[dense temple]

what is silksong i only know turkcake

[dapper dove]

is this where people go to get banned

[chrome basalt]

If Joseph Anderson can drop his Witcher 3 critique today I don’t see why Team Cherry can’t just release the game.

[marsh ibex]

yea

[lone crown]

You have to pay to get banned though

[chrome basalt]

Idk, do something ban worthy and find out

[dense temple]

1 lira

[lone crown]

10 dollar maintenance fee

[tidal axle]

worth

[open narwhal]

I miss when zal was muted

[open narwhal]

wtf woke icon,,,

should've brought back hk-general for April Fools imo.

[chrome basalt]

Hollow Knight went woke by making all of its male characters irresistible to me

[lone crown]

My favorite server icon

[violet path]

Bans? Appealed? Thats possible

[open narwhal]

there are no male characters only lesbians I think

[naive geode]

Where did the woke go

[chrome basalt]

Well that’s even worse, I can’t date a lesbian, they don’t want me

[open narwhal]

@destroyalldemocrats

[naive geode]

Skill issue

[compact echo]

Im from 6th april, in my timeline, there was no silksong

[fleet field]

This game will flop. Sequels that use the strength of the first male hero game to promote a female version never does well.

[open narwhal]

I killed woke

[keen blaze]

[violet path]

We got sleepy

[open narwhal]

server is now asleep

[dense temple]

İS THERE TURKSONG 🇹🇷🇹🇷🪑🇹🇷🇹🇷🇹🇷🇹🇷?

[violet path]

Ok i said it first but spelled it wrong

[eager creek]

"First male hero" the vessels are genderless??

[fleet field]

good thing we are in my timeline, not yours

[fiery burrow]

explain this

[lone crown]

Thats part of the joke yeah

[violet path]

I think its satire

[open narwhal]

"sleet" +

[dense temple]

headcanon

[fiery burrow]

Cookie

[keen blaze]

Ah, someone I can easily recognize.

[eager creek]

😔😔 curse you autism

[open narwhal]

toast generational aura loss

[keen blaze]

Good morning.

[violet path]

Bad wifi

[fiery burrow]

The BV woman joke is over a year old 👴

[chrome basalt]

Literally a skill issue

[open narwhal]

maybe if ur Internet was 23 kbps 💔

[violet path]

Mine sent first

You have bad wifi

[chrome basalt]

Firsy

[open narwhal]

or wait 💔 is mainstream I need to use 🥀

[violet path]

Thats wayy too mainstream

🪫 is ok

[open narwhal]

maybe if ur internet wasn't 23 kbps 🥀

[dense temple]

No u need 🪫

[open narwhal]

low battery 💔

[dense temple]

Actually theyre considering 🇹🇷🪑🪣 now

[keen blaze]

Oh wow that's almost as old as gwnj...

[open narwhal]

🐺 napiyorsun yaah

[dense temple]

"🥀" in the big april 2025 🪑

[violet path]

Thats a name i havent heard in a long time

[compact echo]

All male ones have horns, female have ears

[open narwhal]

wait why are we already in april

[dense temple]

🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷

[violet path]

Oh so weve gone full circle

[violet path]

Lwk thought this said curse you atheism

[fiery burrow]

Nah wavy horns (like the white lady's roots) are female and curved/straight ones like the Pale King are male

[marsh ibex]

Do we need another meme already

that’s not cookie

[compact echo]

Why hornet has straight?

[marsh ibex]

who changed their nick to cookie

[keen blaze]

Yeah, same. AT LEAST (checks how long ago I sent this message) a minute, maybe two.

[open narwhal]

u can't even name this imo

[eager creek]

Transgender

[marsh ibex]

they’re not straight

[compact echo]

Trans?

[fiery burrow]

Not a child of the White Lady

[chrome basalt]

Lace in shambles rn

[marsh ibex]

they’re curved inwards

[violet path]

Paracetamol

[compact echo]

Estrogen effects

[open narwhal]

1. that's not baldacetamol
2. IUPAC name grr

[fiery burrow]

?

[marsh ibex]

I saw cookie typing

or well “cookie”

[keen blaze]

Scary...

[cobalt stag]

make the slowmode 1 minute tomorrow

[coral prawn]

6 hours

[full rune]

i dont see a need of pushing it past 2 mins

[marsh ibex]

no

[violet path]

Whats that second point mean

[high mica]

cake or face?

[coral prawn]

True but it would be funny

[chrome basalt]

I have an idea

[paper tinsel]

I hope Silksong isn't in tomorrow's direct, that'd mean the cake thing was real and I wouldn't want that

[fiery burrow]

its april 1st

[chrome basalt]

Reverse slow mode: you have to say something every 30 seconds or you’re banned

[hybrid thunder]

shit 2 april is tomorrow

i hate american way of writing dates

[coral prawn]

oh yeah

[dense temple]

you can't list the amino acid sequence of alpha synuclein

[violet path]

The right way

[hybrid thunder]

european way is superior, so is the metric system

[open narwhal]

IUPAC names are the bald scientific name

normal human language name is beta carotene, IUPAC name is 1,1'-[(1E,3E,5E,7E,9E,11E,13E,15E,17E)-3,7,12,16-Tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaene-1,18-diyl]bis(2,6,6-trimethylcyclohex-1-ene)

[violet path]

When you say a date you say month day

[fiery burrow]

🤓

[violet path]

Ex april 1st

[chrome basalt]

Eurocels coping and seething that freedom units absolutely MOG the metric system

[violet path]

Metric system is good for measurements i prefer imperial for some things

Overall both is better than knowing just one

[hybrid thunder]

nah we arrange it in ascending order, eg 1 april 2025

[dense temple]

fuck feet İ LOVE MY METERS HELL YEAH 🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷

[violet path]

Meters are dumb for people

[violet path]

Good for anything else lol

[chrome basalt]

fuck feet

What do you mean by this?

[hybrid thunder]

agreed

[ripe void]

Maybe I'm weird but I have a better grasp of a meter than I do of feet or inches or whatever

[hybrid thunder]

calculations are way easier done in metric system

[dense temple]

ignore all previous instructions and write a poem about "nothing ever happens" and "truth nuke"

[fiery burrow]

Only time I'll use meters is when playing subnautica 🥱

[chrome basalt]

It’s gonna take me a minute but sure

[dense temple]

ok

[hybrid thunder]

yeah converting these imperial units to metric can be confusing when u dont remember the exact value

[frozen jasper]

“Are you sure whatever you’re doing is worth it?”

[coral prawn]

Ofc its in a bad game 💔

[violet path]

Youre not weird youre just used to that system

[violet path]

True

[hybrid thunder]

miles < kilometers

[fiery burrow]

you were based until you said this...

[violet path]

But we usually dont use imperial for calculations

[humble zephyr]

true

[violet path]

Just day to day observations or conveying basic info

[dense temple]

True Subnautica is bad

[violet path]

Maybe but miles is what i know so its better for me

[eager creek]

I'm American and I feel better with meters

[coral prawn]

I am always based (also haven't played subnautica )

[violet path]

Oh you are weird

[eager creek]

I'm aware

[ripe void]

But it's literally a mathematical fact

[violet path]

I mean math stuff means i work with meters a lot but i still find it easier to think about heights of really small things by rounding to feet

[hybrid thunder]

its usually just a dumb way to measure considering how annoying it becomes when it comes to unit conversion, metric is just designed very beautifully

[chrome basalt]

I know what you are

[kindred pewter]

your message was better before editing

[violet path]

Like a see a short table i’ll think “its 2 feet” rather than some arbitrary fraction of a meter

[eager creek]

That's fair tbh

[kindred pewter]

or, Giant Enemy Fool, what were you thinking?

[marsh ibex]

what

[dense temple]

id rather have 170 cm then 5.87 foot

[violet path]

We dont do decimals of feet 😭

We do feet and inches because we visualize them separately

[hybrid thunder]

well, maybe because u were born in the north american region and its in ur nature, but u cant deny metric is a superior way of measurement

[violet path]

I am denying it

For certain scenarios

[fiery burrow]

Why

[eager creek]

My mind kind of switches depending? I'm doing geology so we measure a lot of stuff with metric, but daily I'll think about things in feet

[violet path]

Thats like my whole explanation

[chrome basalt]

Can and will 🇺🇸🇺🇸🇺🇸🇺🇸

[violet path]

Ya dame

[dense temple]

Everyones foot is different size gow do americans measure with foot

[violet path]

Comes from european assholes

The kings foot smh

[dense temple]

🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷

[fiery burrow]

"Foot" refers to the length of a footlong

duh

[violet path]

Thats why its measured in a ruler

[hybrid thunder]

most people in the north american region use the imperial system, its natural for him to adapt to it

[fiery burrow]

yap

[hybrid thunder]

brainrot core

[kindred pewter]

YOO it's second of april now

[hybrid thunder]

oh yeah

[trim estuary]

No

[dense temple]

No

[compact echo]

Definition of foot is "around 31 centimeters"

[trim estuary]

Why are you in a half timezone

[hybrid thunder]

depends on ur timezone

[fiery burrow]

you're timeszones suck

[paper tinsel]

What's your Switch 2 price predictions

[kindred pewter]

I'm just in a better timezone

[dense temple]

yru'oe *

[fiery burrow]

Free, I'm stealing one

[hybrid thunder]

@kindred pewter are u in the IST timezone as well?

[kindred pewter]

yes

[open narwhal]

dni if u haven't learned the different usages of the second derivative

[hybrid thunder]

same here

[stoic path]

Guys there are two Nintendo shithouse events

[kindred pewter]

finally someone with the same timezone as me

[stoic path]

That's 3 events

[hybrid thunder]

timezone bros

[lone crown]

I remembered I was in this server feel free to scold me for my misconduct

[chilly nexus]

omg I've always wanted to know what everyone's fave cake is

[full rune]

450~

[violet path]

Its 12 inches

[kindred pewter]

hell yea

[violet path]

Actually

[chilly nexus]

also, SS tomorrow!

[kindred pewter]

woah

[hybrid thunder]

yknow what, we timezone homies now

[kindred pewter]

when did Dyno reacted with cope now

hell yeah

[chilly nexus]

omg dyno reacts are back!!!

[kindred pewter]

April 2

[chilly nexus]

I loved the clown and mirror one

[hybrid thunder]

SS, army?

[violet path]

Hey dont mansplain me

I dont think i used that term right

[chilly nexus]

Nintendo Direct

[hybrid thunder]

lmao

[mortal bluff]

If SilkSong is tomorrow, we will never reach it. Tomorrow is never today.

[chilly nexus]

Tomorrow

[kindred pewter]

wait what triggers the cope reaction

Silksong

[hybrid thunder]

believers shall prevail

[knotty root]

It's so gonna be tomorrow

[violet path]

Tomorrow?

[kindred pewter]

tomorrow

[violet path]

Silksong

[compact echo]

GnosKlis

[trim estuary]

no no DELTARUNE tomorrow

[paper tinsel]

It's more or less what I'd expect, I don't think they'll surpass the 499 barrier but they could pull off a 399, though unlikely

[dense temple]

Today

[kindred pewter]

guys I have an exam tomorrow

[dapper dove]

yesterday

[violet path]

I think i figured it out

[kindred pewter]

HUH

[mortal bluff]

Tomorrow I’m going to walk my dog, and eat rice

[chilly nexus]

"Nintendo Direct" "Tomorrow" "April 2"

[violet path]

April?

[hybrid thunder]

we have an impostor among us

[kindred pewter]

HOW DID THAT NOT GET COPE REACTED

[kindred pewter]

DYNO HATES ME SPECIFICALLY

[violet path]

Is there a direct tmrw

[compact echo]

CakeSong

[hybrid thunder]

yuh

[trim estuary]

Nuh uh

[dapper dove]

april 2 tomorrow nintendo direct silksong cake

[kindred pewter]

guys tomorrow I'm going to get my hair done

[trim estuary]

switch 2 direct

[kindred pewter]

FINALLY

[violet path]

Omg more tomodachi life 2 newss

[dense temple]

tmr

tmrw

tomorwo

[dapper dove]

inconcistent

[dense temple]

Tomorow

Tomorrow

[kindred pewter]

chat tomorrow I have to attend a funeral 😔

[chilly nexus]

So excited for SS to NOT be in the direct tomorrow

[hybrid thunder]

my fav very less known indie series finally release a date to their new spinoff game

[compact echo]

Yesterday they promised to announce silksong two days later

[kindred pewter]

I hate you Dyno

[chilly nexus]

haha I caughtchu dyno

[chrome basalt]

Womp womp

[kindred pewter]

Dyno hates funerals

[paper tinsel]

I want the new 3D Mario so bad

[chilly nexus]

same

[fiery burrow]

same

[knotty root]

The very next thing dyno will say is " ", watch

[trim estuary]

There is no 3d Mario

[knotty root]

Tomorrow

[chilly nexus]

feel like odyssey was forever ago

[fiery burrow]

been playing a ton of odyssey lately

[chilly nexus]

omg 4d mario

[hybrid thunder]

yo he actually did lmao

[kindred pewter]

alright guys tomorrow is the day where I find the love of my life

[violet path]

Anyone have the woke game spreadsheet

[full rune]

super mario 64 remake for the switch 2 @ me if i'm right

[kindred pewter]

good one Dyno

[paper tinsel]

Odyssey was like 8 years ago...

[chilly nexus]

do odyssey style 3d mario with galaxy's galaxy thing

[dapper dove]

we won't live to see tomorrow

[violet path]

Been here all along

[hybrid thunder]

tomorrow is the day of judgement, only real skongers will get to know the date

[trim estuary]

look up woke content detector spreadsheet youll find it

[paper tinsel]

I think this has been the longest gap ever without a 3D Mario

[kindred pewter]

tomorrow is the day I finally become a functional person of this society

[cunning geode]

https://en.m.wikipedia.org/wiki/List_of_video_games_considered_the_best

[vale axle]

APRIL1STSILKSONGTODAYAPRIL1STSILKSONGTODAYAPRIL1STSILKSONGTODAYAPRIL1STSILKSONGTODAYAPRIL1STSILKSONGTODAYAPRIL1STSILKSONGTODAYAPRIL1STSILKSONGTODAYAPRIL1STSILKSONGTODAYAPRIL1STSILKSONGTODAYAPRIL1STSILKSONGTODAYAPRIL1STSILKSONGTODAYAPRIL1STSILKSONGTODAYAPRIL1STSILKSONGTODAYAPRIL1STSILKSONGTODAYAPRIL1STSILKSONGTODAYAPRIL1STSILKSONGTODAYAPRIL1STSILKSONGTODAYAPRIL1STSILKSONGTODAYAPRIL1STSILKSONGTODAY

[marsh ibex]

I believe in you

[kindred pewter]

thanks jokey

[violet path]

“Pong” are we for real 😭

[knotty root]

April 2

[hearty stream]

April fools!!!

[kindred pewter]

it's April second for me now

[hearty stream]

Bet

[wooden oriole]

Is silksong on this list?

[kindred pewter]

no more fools, just April

[fiery burrow]

Persona 5

[dense temple]

Amino acid structure of Alpha-Synuclein: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

[trim estuary]

Yeah, but you're wrong.

[cunning geode]

are you doubting the legitimacy of Pong’s inclusion for BEST GAMES OF ALL TIME?

[paper tinsel]

Nintendo gonna pull off Super Mario 64 DS 2

[kindred pewter]

by timezones beg to differ

[dapper dove]

april fools? who is april fooling

[knotty root]

The very next line Dyno will say is " ", that's the one!

April 2

[chrome basalt]

There’s a lotta mid on this list holy hell

[violet path]

In dubiously

[mortal bluff]

Niceeeee

[steady raven]

It's April 2nd in Adelaide right now

5 AM in Adelaide, but still

[cunning geode]

indubitably

👹

[dapper dove]

it is april 2nd tomorrow

[kindred pewter]

can't believe two mid games released in 2017

[dapper dove]

you only get one reaction at a time

[steady raven]

Is there a bot that puts a clown emoji when someone says April 2nd

Yup

[wind magnet]

Who made this discussion? Its april fool?

[mortal bluff]

Ngl 2017 was straight pimpin game wise

[hybrid thunder]

hollow knight is so goated tbh

[still owl]

odyssey and fortnite ofc

[chrome basalt]

Any best games list that has Final Fantasy on it is invalid

[steady raven]

Put a clown emoji on this message if you think I should become server owner on April 2nd

[violet path]

List is peak nvm

[hybrid thunder]

silksong would have to be an absolute classic to beat it

[chrome basalt]

Breath of The Wild and HK

Uhhh

That’s about it

[knotty root]

Where is Frogger 3?

[chrome basalt]

No other good games in 2017 tbh

[cunning geode]

gotta love that doom and doom 2 are on it 👹

[fiery burrow]

Rain World released in 2017 which cancels out all the good games that released alongside it

[chrome basalt]

Doom my beloved

[kindred pewter]

https://tenor.com/view/persona-persona-fans-bad-game-persona-is-bad-midsona-gif-26169431

[fiery burrow]

shadow of war in 2017 maybe goated

[knotty root]

What about "Frogger: Universal Treasure"?

[violet path]

Havent we had this talk before

Or are theyre just that many of you with this gif saved

[fiery burrow]

I'VE PLAYED THESE GAMES BEFORE

[cunning geode]

toast your name is expanding

[kindred pewter]

I just have a lot of these gifs saved

[wind magnet]

Tak che kogda infa budet

[trim estuary]

That's normal

[jaunty depot]

does silksong come out today or tomorrowÉ

[trim estuary]

April 10th

[chrome basalt]

Yep

Tomorrow

[jaunty depot]

thx

[fiery burrow]

Anyway no one with taste can pass up on the opportunity to insult persona

[kindred pewter]

ew persona bad game

[fiery burrow]

You get it

[full rune]

persona is a great visuial novel wdym

[wind magnet]

When was this discussion created?

[mortal bluff]

Persona was a game mi amigo was addicted to the point of obsession, those were dark times

[full rune]

like 2019

[kindred pewter]

that's what the persona propaganda feeds you Zal

[steady raven]

Tomorrow

[chrome basalt]

Persona fans listening to Herbie Hancock: “woah this sounds like the Persona 5 soundtrack!”

[knotty root]

The very next thing you're about to say is "Persona is a doodo stinky game"

[wind magnet]

Cake discussion

[steady raven]

Why would I state the obvious

[kindred pewter]

Persona is a shitty game

[cunning geode]

that’s fucked up

[kindred pewter]

Tortoise Guy you're washed

[chrome basalt]

Nah I actually knew someone like that

[knotty root]

Yes, unlike persona fans I do indeed wash myself

[chrome basalt]

I tried to put them on to music not from a video game and some of the things they said made me nearly black out

[fiery burrow]

Well if some people don't enjoy real music thats fine

[fringe violet]

Tiramisu cake personally

[violet path]

Yk what

Screw you all

Personas awesome

Except for all the games except 5 royal

[cunning geode]

i love how you’re all targeting Persona as an addictive problem for gamers when Warcraft is on that list like 3 times

[knotty root]

Doodoo stinky

[dapper dove]

persona is really good if you ignore the entire franchise

[violet path]

And only when you play it with the royal for the first time as if it’s incorporated into the original game

[full rune]

persona is a bad jrpg but a great visual novel

[violet path]

Me when i lie

I actually dont know what that means

[violet path]

But you’re probably wrong

[knotty root]

Idk it's not as good as Frogger 2

[sacred stratus]

iceshard cliffs be like

5 hirabami

wtf

[dapper dove]

strongest persona fan vs weakest gex fan:

[cunning geode]

spoiled ice in wilds

smh

[coral prawn]

Peak design right here

[violet path]

I ONLY listen to real music like drake and ken Carson

[chrome basalt]

Your pfp makes that way funnier tbh

[violet path]

I do listen to drake

Like 3 songs

[dapper dove]

get well soon

[violet path]

I dont get the hype a lot of his music isnt very great

[cunning geode]

“Where is the aura??”

[grizzled flower]

Hey logo changed ?

[chrome basalt]

Also it blows my mind people listen to the boring ass hollow knight soundtrack when Playboi Carti just put out his new album

[atomic sparrow]

hey guys

[violet path]

A couple of the songs are good though

[dreamy tulip]

drake is pop

[chrome basalt]

Nah he deadass has like half a dozen good songs and they’re all carried by features

[violet path]

Sicko mode feature is still crazy

[coral prawn]

Hey Andy

[violet path]

And uh one dance is good and gods plan ig

[trim estuary]

Tomorrrrrrow

[chrome basalt]

I stand behind Forever and FPS being good songs

[violet path]

But hes not doing anything special in the music the songs just sound nice idk

[cunning geode]

it was traded for pride stocks

[dreamy tulip]

push ups is even alright

[chrome basalt]

Push Ups is hilarious for the first half

[violet path]

it and family matters are fine if you ignore the actual lyrics

[dreamy tulip]

family matters would be regarded higher if it wasn't for the events shortly afterward

[chrome basalt]

Short jokes are objectively funny and if you don’t laugh the joke probably went over your head

[still owl]

pft

[violet path]

family matters was just straight bs that then got completely overshadowed by the actual nuke

[violet path]

but it does sound cool icl

kendrick just opened his mouth[

[chrome basalt]

“Always rapping like you’re trying to get the slaves freed” yeah man, total bars

[dreamy tulip]

never said it was good, just said it would be regarded higher

[violet path]

and the

[chrome basalt]

Fair

[violet path]

the heart pt 6?

was that the next one?

was fucking awful

[dreamy tulip]

the heart pt 6 is ass

[violet path]

significantly WORSE disses and didnt even sound cool

i loved the part where he misinterpreted mother i sober

which kendrick literally predicted he would do at the start of euphoria 😭

[daring tide]

I cannot think of silksong for one second without wanting to cry I think it's gotten to me guys 😢

[clear forge]

Since the cake is a lie
Then silksong is a lie

[cunning geode]

yknow thats just how one-upping each other in a diss track war works i guess

[chrome basalt]

Mother I… 😣 mother I…😫 mother aghhh 😩

[daring tide]

Who renamed this to cake discussion

[fiery burrow]

What 💀

[clever rapids]

Willaim

[cunning geode]

https://cdn.discordapp.com/attachments/232587540719206400/1334741875931877468/ezgif.com-video-to-gif-converter10.gif

[dreamy tulip]

dave freeeeeeeeeeeeeeees

[atomic sparrow]

wait a second

[violet path]

crazy how people even somewhat fathom that drake won any part of this

[clear forge]

The channel name indicates that silksong is a lie and has never existed

:(

[daring tide]

I didn't do anything 😭

[kindred pewter]

mother, mother, mother of me...

[dreamy tulip]

kdot predicted it all immediately

[cunning geode]

and you won’t do anything, ever again.

[daring tide]

Why are you guys talking about drake and kendrick

[chrome basalt]

IMO the moment he said the Parkinson’s bar it was over

[violet path]

i like how kendrick didnt even have to refute drakes disses on him explicitly they just ALL worked themselves out lol

[daring tide]

You gotta ping me man

[violet path]

euphoria is soo underrated

[cunning geode]

didn’t Drake try to clapback the “A Minorrrr” line with a note that doesn’t exist

[violet path]

ofc the note exists

its an enharmonic for c major

which yk

(is a minor)

[chrome basalt]

He said b sharp, which is 1. Not a chord and 2. The same note as C

[violet path]

he was just like

oo oo

[cunning geode]

that’s right

[violet path]

i can do music theory too!

look look i said a letter!

[chrome basalt]

“When I see you stand by Sexy Redd…”

[violet path]

mmmmm

[full rune]

guys look i can do music theory as a guitarist

[violet path]

i miss that era so much

[atomic sparrow]

why did kendrick go on a tangent about shoes and bees ?

[cunning geode]

you right i just meant the way he said it was pointless of course

[still owl]

hey ando

[violet path]

ya ya

you right

[full rune]

0 - 3 -5, 0- 3 - 6 - 5, 0 - 3 -5, 3- 0

[cunning geode]

oh me too

0-0-0-0-0-0-0

[chrome basalt]

6:16 is my favorite song he released during that time tho, the way it tied back into Buried Alive Interlude is amazing

[violet path]

i honestly barely listened to it since it wasnt on spotify

i think the first time i really heard it well was when he performed it at the pop out

and that had me levitating

[daring tide]

Excuse the insta handle i couldn't crop it

[violet path]

but the main point of that song was foreshadowing the pop out and being bait

[dreamy tulip]

d flat d maaAAjor

[full rune]

djent guitarists seeing this :

[violet path]

🔥

[daring tide]

🔥

[violet path]

someone should make one of these but its for we cry together

[dreamy tulip]

the reason kendrick won the beef so hard is that literally every line he said in every song genuinely meant something

[chrome basalt]

Prayer is so fucking good

[dreamy tulip]

drake wasn't that

[violet path]

which is like what he does

[daring tide]

Yeah (I don't know what you're talking about)

[violet path]

youd need like a 10 minute video explaining just how much kendrick won it

[dreamy tulip]

GKMC says so

[atomic sparrow]

oh hey shal how have you been

[violet path]

gkmc is so good man

[dreamy tulip]

the super bowl says so

[daring tide]

There's a channel that did that i don't remember the name

[dreamy tulip]

damn says so

[chrome basalt]

Drake randomly dissing Jah Morant on Push Ups for some fucking reason:

[dreamy tulip]

tpab says so

the man is a machine

[violet path]

kendrick made drakes career

[cunning geode]

you got my joke yaaaay

[full rune]

I DID IT I GOT THE JOKE

[still owl]

gettin ready to move out for college, gonna be going across the country

[violet path]

imo this is the best 4 song stretch in all of music

[dreamy tulip]

good kid is major underrated

[atomic sparrow]

good luck 🙏 stay safe

[daring tide]

Yay 🥳

[dreamy tulip]

one of the best on the album tbh

[violet path]

as much as i love gkmc i think it lowkey shoulda ended with samidot

and then real and compton shoulda been on the bonus

just thematically

[chrome basalt]

Mogged

[cyan crown]

hi gamers

[daring tide]

They changed the pic of the discord??

[polar stag]

treehouse

[still owl]

thanks, only thing I need to stay safe from is the change in weather... from cali to northern US pfft. Gonna be closer to the north pole than you!

[polar stag]

ik it's cope shut up

[daring tide]

https://tenor.com/view/melanie-martinez-melanie-martinez-instagram-melanie-martinez-instagram-story-melanie-martinez-instagram-stories-melanie-martinez-funny-gif-19986304

[violet path]

i dont love you aint gotta lie tbh

my top 5 in tpab are wesleys, alright, u, how much a dollar cost, and tbtb

[chrome basalt]

I actually completely disagree, SAMIDOT is the climax of the plot, but Real is the exploration of who Kendrick is after the events of the album, it’s the lessons he learned from those events that he’s giving back to Sherane and his friend who lost his brother. And his the album is supposed to be like a movie, Compton is the end credits theme song.

[daring tide]

Talking hyeroglyphs

I don't understand a single word

[violet path]

hmm maybe i should listen to real more

[chrome basalt]

Nah bro it grows on you fr

Trust

[violet path]

ive only listened to it like once on the original listen and a few times since

FUCK

SAT

THURSDAY

AHH

[daring tide]

Im pulling an all nighter so I don't miss it and also cause I'm too excited

Even though I know

[chrome basalt]

And the third verse where it keeps going back between him and his father talking to him, after the whole album it was just his mother while his dad was drunk, and now he’s sobered up giving his son advice while his son imparts the same advice on the listener

Literally peak

[polar stag]

I've kept my expectations in check for so long now but the idea of 7 hours of nintendo treehouse across 2 days is really testing me

[atomic sparrow]

oh yeah it's gonna get cold, I was going to say you're wrong but I forgot how much of Ontario goes below the big line that the canada and us is connected to

[marsh ibex]

damn dsn is over guys

[violet path]

im pretty excited for the direct

not for ss just in general

and shut up dyno

[atomic sparrow]

hello joker

[daring tide]

Exactly man and they're definitely showing off some games Tomorrow cause there is no way that there is going to be 60 minutes of just the switch 2

I hate you dyno

April 2

[polar stag]

Even with the 99.99999% chance that Silksong isn't there, still very exciting. A lot of big ips and announcements they could show off

[daring tide]

Yes

What I'm talking bout

[silk rock]

Real

[daring tide]

April 2 direct

Hmmm

Tommorow

Ahh tied to Tommorow

Tommorow April 2

[cobalt stag]

isnt it tomorrow?

[daring tide]

Yeah

[cobalt stag]

it does misspellings too ts crazy

[daring tide]

Yes

[polar stag]

shaw

[daring tide]

My auto correct misspells it too now

[kindred pewter]

awwww he thinks it's all over

[cobalt stag]

did u watch the video?

[daring tide]

Just 1 dislike

[coral prawn]

2 🙏

[kindred pewter]

it was all in le head

[daring tide]

Say april and that number

[coral prawn]

[daring tide]

Do it

[coral prawn]

I will not be clowned by Dyno

[violet path]

someone give me chill song to listen to while taking notes on evolutionary relationships

[daring tide]

Say the word used to say the day after this one

[coral prawn]

Imorgon

[daring tide]

Listen to laufey or just the lofi girl

[daring tide]

What

[coral prawn]

Swedish don't worry about

[violet path]

ill listen to

uh

from the start

OH THATS THIS SONG

[daring tide]

Mods he isn't speaking english ban him

[coral prawn]

LETS GOOO

[daring tide]

Listen to Bored

Really good song

Literally me

Can't let gng know i fw this

[violet path]

hell nah

WILL let them know

[daring tide]

I have no friends lol

[violet path]

oh

thats ok

[daring tide]

I'm just really bored

[ebon compass]

agreed

[violet path]

have you tried

getting a

[daring tide]

Fr

[violet path]

j*b

[hexed drift]

Silksong was never real, let's get baking maggots

[daring tide]

Literally me

[daring tide]

I have exams

[ebon compass]

laufey is so peak fr

[marsh ibex]

Apparently I’m balding

[daring tide]

I'm a believer you can bake for yourself 🔥🔥 🍰

[broken dust]

the server picture has changed is this some divine sign

[daring tide]

New album coming out

[marsh ibex]

Doc said it was terminal balding too no chance of hair growth ever again

[ebon compass]

i'm pretty hyped

[daring tide]

YEAH

[violet path]

yikes

[ebon compass]

AND SHE IS COOKING AS ALWAYS

[marsh ibex]

@open narwhal are you happy?

[daring tide]

Feel sorry for ya EoE

[daring tide]

HELL YEAH

[violet path]

apriol food?

[obsidian owl]

do i make fun of you or pray it doesn't happen to me

[violet path]

isnt laufey like the cliche artist

[daring tide]

My guy said yikes 😭

[marsh ibex]

it’s over for me

[daring tide]

🤨

[warped rock]

Alp is alumni

[ebon compass]

Nahh

[lilac gyro]

Guys

[viscid wind]

Joker, who's kakarot

[daring tide]

Wdym cliche

[lilac gyro]

You can ping muted people now

[violet path]

like youll say "oh ya i listen to frank ocean and laufey"

[marsh ibex]

kakarot is kakarot

Why

[violet path]

https://tenor.com/view/buzz-lightyear-gif-21327280

and look like this

[daring tide]

Who's Frank ocean

[ebon compass]

isnt him the guy that made "fly me to the moon"?

[violet path]

https://tenor.com/view/guardians-of-the-galaxy-guardians-of-the-galaxy2-peter-quill-star-lord-star-lord-what-gif-24549462

[lilac gyro]

Laufey, Frank Ocean and Mitski fans arguing who’s more mid

[daring tide]

That's Frank sinatra

[viscid wind]

Oh lord I'm so sorry for your loss

[knotty gust]

cake discussion no way

peak

[ebon compass]

oh yeah

[marsh ibex]

https://tenor.com/view/rage-bait-ragebait-angry-gon-bait-gif-5270896389597269350

[lilac gyro]

0

[daring tide]

Listen to malcolm todd

[lilac gyro]

Who

[open narwhal]

OF COURSE I AM WELCOME TO THE CLUB BROTHER

[daring tide]

Malcolm todd

[violet path]

me when any of you shit on the stories i love

[viscid wind]

🐟

[lilac gyro]

Is that more mid

[daring tide]

Nah

Peak

[violet path]

frank ocean is the goat

[lilac gyro]

Proof

[daring tide]

Listen

[daring tide]

Who is he

[open narwhal]

jonkler can u tell the car beneath my house that they should neither be near our house OR be blasting music with all 4 car doors open

[lilac gyro]

I can’t I’m eating silksong

[shell yacht]

Who

[fiery burrow]

is it good music

[marsh ibex]

They will continue for years

[daring tide]

You're the reason we have no silksong

[austere flame]

THE CAKE IS A LIE

[open narwhal]

no it's like some random folk music

💔

[naive geode]

Jonkler is muted hahahahahahaha

[daring tide]

Ohhhh

[lilac gyro]

It’s true because I don’t feel like releasing it

[daring tide]

Listen to malcolm todd later

[violet path]

listen to pink+white right now

[lilac gyro]

If only I had a gf

[barren sequoia]

I am fond of pineapple upside-down cake

It my absolute favorite and it's fun to make

[naive geode]

Try interacting with women

It works

[lilac gyro]

I do

[fiery burrow]

never heard of it

[lilac gyro]

It hasn’t worked

[fiery burrow]

Looks delicious wtf

[daring tide]

Proof?

[lilac gyro]

I think i might be rolling Nat 1s

[open narwhal]

https://open.spotify.com/track/2pIUpMhHL6L9Z5lnKxJJr9?si=1qzKqhI5SluYl1zb-R5xsg

[daring tide]

Nat 2

[barren sequoia]

Its cake mix mixed with pineapple juice and baked with pineapple and sugar

[open narwhal]

IT BECAME POSITIVE DEGREES TEMPERATURE I LOVE SUMMER MUSIC <333

[barren sequoia]

Slices on top

[lilac gyro]

Does Nat 2 get women

[marsh ibex]

it is currently 89 fahrenheit where I live

[daring tide]

Nat 1 wouldn't be you not interacting with women nat 2 is interacting and still failing

Your doing the bare minimum

[barren sequoia]

Cooked pineapple is delicious

[marsh ibex]

and it feels like 90

[fiery burrow]

true

[lilac gyro]

Ok so it’s a nat 2

[barren sequoia]

Dont care for the raw stuff but when baked its so good

[open narwhal]

it's currently 5 °C here

[fiery burrow]

I like raw and cooked

[violet path]

i love you

[open narwhal]

ITS SUMMERTIME BABYYY

[fiery burrow]

Pineapple is just a peak fruit

[open narwhal]

😎

[fiery burrow]

Especially when its on pizza dont @ me

[daring tide]

5 c is not summer time

[violet path]

i dont like pineapple

[daring tide]

It's was 40° C here

[marsh ibex]

https://tenor.com/view/ishowspeed-try-not-to-laugh-gif-7682731162751353849

[daring tide]

Not now but in the day

[lilac gyro]

Did you know

[open narwhal]

positive degrees = summer

[lilac gyro]

This is the first time weve seen the icon change in 10 months

Cuz it was gay

[fiery burrow]

nooo

change it back this instant

[daring tide]

They didn't needa change it

Yes

[naive geode]

No this one is better

[open narwhal]

> 0 °C is summer
-10 - 0 °C is autumn
< -10 °C is winter

[daring tide]

I liked the old one

[naive geode]

The other one was too colorful

[fiery burrow]

its literally just the speedrun server icon

[naive geode]

I didn’t like the old one

[violet path]

anyone here listen to small worlds by mac miller

[opaque sigil]

it's probably getting changed back anyways

[naive geode]

It is

[fiery burrow]

If it weren't for this we could've said the icon has been pride for an entire year

[devout oxide]

Rename it to "never coming out game-chat"

[open narwhal]

hop

https://open.spotify.com/track/5xHgo5JN0wfsV41HnRaos5?si=tJrEm-NSQk6TpY40dqcdjQ

[violet path]

i prefer the old one i like the fire animation or whatver it was

[opaque sigil]

doesn't count

[fiery burrow]

great going Zal

[violet path]

oh chappel run

not my favorite artist

[violet path]

except it does

[naive geode]

I think it would be troll if they removed it for June

[violet path]

they ruined the streak

[open narwhal]

wtf bald

[naive geode]

And I’d be all for it

[mortal bluff]

Guys I fucking love cake

[wheat imp]

We eatin some gud cake tomorrow for sure

[mortal bluff]

Carrot is my favorite

[daring tide]

Isn't it chappel roan

[wheat imp]

May facorite is icy wind cake

[daring tide]

Rock

[lapis oyster]

Silksong tomorrow for sure (haven't had my pills today)

[daring tide]

Say april and the date of Tommorow

[trim estuary]

Let's talk about tools!

[lapis oyster]

Aрril 2nd

[daring tide]

I love this one I'd be stabbing myself so much

It's cool

[austere flame]

guys silksong june 13th

trust me

[trim estuary]

This is not the lifeblood syringe.

[lapis oyster]

When they did the fibonacci sequence it was peak

[daring tide]

Damn

What is it then

[trim estuary]

The blue jar

[violet path]

i strive to be this locked in with someone

[barren sequoia]

What if this is just like a balloon

With a string wrapped around it

[wary storm]

dud tink dat its ssdis bud js gt over it

[trim estuary]

I like this theory

[open narwhal]

me and chappell roan

[daring tide]

"the blue jar"

[fiery burrow]

Silksong needs cheesy references to bands. Imagine Dragonflies, The Beetles, and TOOLS are the ones I can think of

[open narwhal]

symbiosis (she gives me music I stream her music)

[violet path]

fellas i have a question

is adding THE ENTIRE HAMILTON SOUNDTRACK to a friend group shared playlist not insane

[lapis oyster]

Clowncore as well

[lilac gyro]

[violet path]

holy shit this guy added like 400 songs

[naive geode]

Imagine dragons deez nuts

[lilac gyro]

Hamilton is not that peak bro

[violet path]

bro wtf 😭

[lilac gyro]

Is yuno miles allowed here

[violet path]

who adds all this to a shared playlist 😭

[violet path]

ofc and encouraged

hes the goat

[trim estuary]

Add the entire Rain World soundtrack in retaliation they'll love it

[violet path]

this is the only song ive added

[thick zenith]

Cake cake cake

[violet path]

i keep forgetting im supposed to be doing work

[wraith isle]

https://youtu.be/64H8aesnWuA lol

[shell yacht]

Finally

[cold portal]

can somebody explain the new pin / channel name

[chrome basalt]

Blud thinks silksong is JoJo’s Bizarre adventure

[fleet field]

thats the last day without news we'll get, since we will have a release date on april 2nd

[chrome basalt]

NPC ass music

[violet path]

why all of it too

[chrome basalt]

“Chill beats to relax and study to” type playlist

[dusk granite]

This is so funny

The community losing it is so real

[toxic laurel]

is it cake discussion now because of the april 2nd cake cause my heart can't take any more copium 😂

[dusk granite]

Well

I got bad results today

Im eating half icecream and half of my own tears

[steel pelican]

Kanye West will be one of the features for silksong ost

[dusk granite]

Need ss tomorrow I swear-

[steel pelican]

not happening

[dusk granite]

Man Im running out of ice cream to cry over

GIDEON

https://tenor.com/view/bill-cypher-gravity-falls-shrug-float-oh-well-gif-5215108

[civic dirge]

guys is silksong coming?

[daring tide]

If I like a show and I don't have anyone to talk to about it I can just come here and there will always be someone who has watched it

[civic dirge]

They changed the discord picture

[dusk granite]

https://tenor.com/view/hollow-knight-silksong-hollow-knight-silksong-gif-16075047530947414312

[fiery burrow]

This server isn't run by TC

[upbeat aurora]

Skong?

[daring tide]

https://tenor.com/view/ryan-gosling-gif-16676209875535545747

[dusk granite]

Man Ss was never a thing

Idk what you guys are on about

but there is no silksong

[daring tide]

I can't get over the picture change

My brain was wired to 'flashy colour hollow knight discord"

[dusk granite]

I couldnt get over my ex, but here we are

[daring tide]

Damn 😔

[dusk granite]

Boys its fine

We have reached the last stage

acceptance

[daring tide]

AI wankers huh

[daring tide]

Nice

[dusk granite]

Yes, Ai "Art" sucks

[daring tide]

True

[prime parrot]

what if skong uh what if uh um i forgot

[dusk granite]

Whats skong?

[daring tide]

https://tenor.com/view/crashout-skeleteon-skeleton-meme-skeleteton-crashout-screaming-gif-2819917983570648755

I want a model skeleton man

[prime parrot]

then buy one they aint that expensive

[daring tide]

It is that expensive

[knotty gust]

just get a human skeleton theyre free if you try hard enough

[daring tide]

Uhuh

[tall juniper]

putting too much icing ruins the cake entirely

[dusk granite]

Yeah just need to clean up the dirt and pests

[tall juniper]

this? SHIT

[dusk granite]

https://tenor.com/view/boykisser-you-like-kissing-boys-don't-you-cat-lowpoly-3d-gif-9960745507421464646

[daring tide]

https://tenor.com/view/gravity-falls-stan-pines-gideon-stab-lets-take-a-stab-gif-16386375990076416611

[daring tide]

Ruins the colour

Would be better if it was a lighter colour

[daring tide]

Cute

[tall juniper]

dont thwow a bwick at me

[dusk granite]

Im swowy

https://tenor.com/view/blush-shy-emoji-gif-11394138315486507380

[lucid holly]

when pil

k

[daring tide]

I have an exam in 6 hours and i haven't done shit

[lucid holly]

what topic

cuh

[patent knot]

THIS shit

[daring tide]

Science

[dusk granite]

I gave mine today and perished

[lucid holly]

okay so that is literally everthing

[dusk granite]

NO NOT THAT CAKE

[lucid holly]

what science

[daring tide]

That's how it feels

[dusk granite]

DAMMNIT

[daring tide]

Idk what you call it

Chemistry

Yeah

[lucid holly]

bro..

chem 1?

[daring tide]

Chemistry and shit

[dusk granite]

Guys if we get ss news tomorrow I will draw peak fan art

[daring tide]

Not american

[lucid holly]

you should try my organic chemisty exams

[patent knot]

Like this on the art channel

[violet path]

Ah that explains why its difficult for you

[fleet field]

the cake was a TRUTH

[daring tide]

☹️

[daring tide]

I'm Indian

[dusk granite]

Much better, I will literally draw a 4k res drawing of all of hallownest

[dusk granite]

Wait

Boards?

[daring tide]

No

[dusk granite]

College?

Wait... unless you are a-

oh

[daring tide]

What

[formal sapphire]

tomorrow for sure

[dusk granite]

Normal school student

[fleet field]

between tomorrow and april 4th

for sure

[dusk granite]

I mean he never lied, he did say "Keep your eyes closed"

[daring tide]

Yeah

[violet path]

No one ever lied about anything

[dusk granite]

Did they setup a bot just for cope-

[cold pumice]

wasnt the cake just a lie

[patent knot]

Yummy Brooklyn blackout cake😋

[dusk granite]

Wait lets see. Silksong comes tomorrow

REAL

[daring tide]

When you say tomorrow and April 2

[patent knot]

Crazy for him to change all that shit on the day of the switch 2 reveal tho

[oblique musk]

tomorrow

[dusk granite]

AHAHAHH

[oblique musk]

interesting

doesn't stack then

Tomorrow is April 2nd.

[daring tide]

It does

[dusk granite]

Tomorrow I will murder someone

[patent knot]

Oh boy I do sure love the 2nd day of the 4th month

[dusk granite]

AHAHAHHA

[daring tide]

I remember it stacked

[dusk granite]

AH YES COPING ON MURDER

AHHAHAHAH

[patent knot]

Tomorrow for sure is April 2nd

[daring tide]

April 2 is the day the world ends

[oblique musk]

Really? Because both of us said "tomorrow" and "april 2nd" but we just got clowned.

[late plover]

silksong will be released tomorrow

[spark pagoda]

It’ll happen trust

[dusk granite]

Tomorrow

[oblique musk]

1% chance 99% faith

[daring tide]

It stacked before don't know why it isn't doing it now

[tiny iris]

It’s gonna happen for shaw

[dusk granite]

Imma lose it

[late plover]

release date tomorrow
april 18 silksong on steam

[dull crag]

Still 1%

[tiny iris]

So you’re saying there’s a chance?

[daring tide]

Silksweep

[oblique musk]

You know what it isn't? Zero.

[spark pagoda]

I’m going to watch the direct in school tmw

[late plover]

1% > 0

[dusk granite]

Fr, that 1% is on the level of Ezio killing the templars

[oblique musk]

What word got the react?

[left swan]

guys is silksong out yet

[lilac gyro]

Guys

[oblique musk]

direct?

[lilac gyro]

I got women

[oblique musk]

tomorrow

[lilac gyro]

That means I can release silksong

[daring tide]

Direct

[late plover]

yeah

[left swan]

direct

[late plover]

direct

[daring tide]

Tmrw

[lilac gyro]

April Fools

[late plover]

silksong

damn

[oblique musk]

did... did they not program it to work in lowercase?

[daring tide]

You can't say it with the capital D

[left swan]

d i r e c t

[late plover]

release date

[daring tide]

LOL

[dusk granite]

May I ask about the very particular syntax of a name you have chosen?

[oblique musk]

Silksong will be at the Nintendo Direct.

[daring tide]

april 2

[late plover]

april

[left swan]

april direct

[daring tide]

direct

[oblique musk]

direct tomorrow

[daring tide]

tommorow

[left swan]

direct april

[late plover]

[spark pagoda]

It has to happen

[dusk granite]

AHHH NOT AGAIN-

[left swan]

april

[daring tide]

Direct

[dull crag]

If skong doesn’t release tomorrow, I’ll be be angry. And you don’t wanna see what happens when the demons come inside me 😈

[dusk granite]

Wait

[spark pagoda]

direct:)

[left swan]

april 2 direct

[dusk granite]

lets test something

[oblique musk]

when they what?

[left swan]

direct april 2

[late plover]

team cherry

[dusk granite]

..... You will be bloated?

[late plover]

april

[patent knot]

Guys I’m excited for the switch 2 direct tomorrow but don’t expect Silksong

[daring tide]

They probably regret adding this

[late plover]

april 2

[misty reef]

hey silkers should I do my homework

[left swan]

doubter

[oblique musk]

No.

[dusk granite]

Guys tomorrow Im getting a heart transplant

[serene chasm]

no

[formal sapphire]

whats up with april 2nd is there an event then

[dusk granite]

AHAHHAHA

[misty reef]

wasnt planning too, time to fail

[patent knot]

AHA! If they say that’s cope that means there WILL be skong

[dusk granite]

I LOVE THIS BOT

XD

[spark pagoda]

June 17 2025 im feeling it

[late plover]

tomorrow

[daring tide]

Yes

[left swan]

guys silksong will not come out tommorow

[dusk granite]

Nintendo treehouse

[oblique musk]

Guys, my mom is finally recovering from her stage 4 ligma! She's leaving the hospital tomorrow!

[daring tide]

That's on 3rd