general_chat

[primal harbor]

ya know

i think its winters fault

wash your paws

[outer kiln]

(laughs in knowing some spanish slang)

[outer sparrow]

https://klipy.com/gifs/hangin-with-the-plug-on-it

[crude sleet]

damn, chatgpt doesnt think I should turn my PC into a monster

[hallow sleet]

nah

[crude sleet]

welp, there goes my weekend plans

[outer kiln]

LJ no tiene huevos. Qué triste

[outer kiln]

@outer sparrow google translate this

[patent grove]

[outer kiln]

https://tenor.com/view/evil-laugh-muahaha-patrick-star-fire-flames-gif-26595631

[crude sleet]

also, has somebody tried throwing the audio glitches in caine's crashout into a spectrogram?

[outer kiln]

how does one spectrogram?

[stark vessel]

https://cdn.discordapp.com/attachments/592597586263932932/1378821576769671208/flag.gif

[crude sleet]

the glitches are the same in all language versions

[outer kiln]

hmmm

send me the audio tek

[outer sparrow]

if it does turn it into a monster you should can it... i heard the juice is yummy

[crude sleet]

https://youtu.be/KtbWwmG6XTk?si=ZNU68p7tw4-sc_Kp

I only got this

[outer kiln]

can you do youtube to mp3 for me?

i'll plug it into audacity

[near topaz]

https://youtube.com/shorts/tfH041lucAQ?si=9ShdlxUg0V3T8d6- so like this is just blatantly for stealing to train ai right? Like why else would they take the time to make their program more restrictive by making you store your stuff on their cloud instead of locally for absolutely no reason?

[crude sleet]

why cant you? lol

[outer sparrow]

https://klipy.com/gifs/timon-and-pumbaa-inflation

[outer kiln]

alright i'll be back

[crude sleet]

the furry fandom has ruined me

[hasty lagoon]

LMFAO NOT THE BASS PRO SHOP

[outer kiln]

I was wrong you do have a large singular heuovo

[hasty lagoon]

If there’s a bass pro does that mean there’s a bass pro max

And a bass plus

And a bass s

[crude sleet]

https://youtu.be/E0zr_pcHYDI?si=jE8dQrX_xoDhWBSt

[hasty lagoon]

And a bass e

[crude sleet]

oh great heavens!

[hasty lagoon]

Does the furry ever sleep

[outer sparrow]

ah yes the Adobe way of your art is ours now

[hasty lagoon]

AUB FWEN ^^

HAI :D

[crude sleet]

do you?

[hasty lagoon]

Huh

Wait

The furry

Is an AI

This is why ram costs 5 billion

[near topaz]

Yeah like bruh that is the most blatant theft ever, there is no other conceivable reason to have your devs sit down and change the program to no longer allow you to just save locally. There has to be a motivation for your stuff being on their servers, that takes up space and money

[stark vessel]

NO TEK! DON'T CREATE A DIGITAL COPY OF YOURSELF! TEK!

[crude sleet]

too late

I already passed my brain scans off to this weird creative AI system im making

[outer sparrow]

Tek the self pirate?

[near topaz]

#piracy-requests

[outer sparrow]

-_-

smarty pants

[hasty lagoon]

Jezza are you an Australia?

Do you the kangaroo?

[near topaz]

Do not the kangaroo

[hasty lagoon]

https://tenor.com/view/balthazar-kangourou-fin-de-semaine-nice-gif-12474946125265043076

I will roo the kanga

[crude sleet]

test

weird

[near topaz]

Fail

[hasty lagoon]

Fail

[crude sleet]

my computer is saying it doesnt have internet

[outer sparrow]

https://klipy.com/gifs/muscle-man-1

[hasty lagoon]

Looser

[hasty lagoon]

Yes cause all your bandwidth just went to Claude silly

They are crunching AI slop code via your internet now

[hasty lagoon]

Damn why he swole

[outer sparrow]

because kangaroo

like to drown predators like dingos and dogs

[hasty lagoon]

What

That’s some psycho shit

[plucky lark]

Speaking of. i found out of something stupid earlier that is real as Primeagen actually tried it out. Malus

it is no joke a service where you can pirate open source projects... https://malus.sh/

[hasty lagoon]

Predators….predditors

Huhhhhh

That explains a lot

[primal harbor]

lmao

[hasty lagoon]

Hehehe

[near topaz]

Saw a dnd concept where resurrection spells take the diamond as payment for the soul you’re bringing back, which yknown isn’t anything new, but put forward the idea to still allow your party to cast the spell without the component, cheating death out of their payment and as such having to fight an avatar of death puss n boots style. Not necessary with the intent to kill the party (if they die they die tho lol), but to impress upon them the weight of death and severity of death

[outer kiln]

here Tek

[outer sparrow]

sus link is sus

[near topaz]

So like probably gonna use that in the future lol

[frail otter]

https://giphy.com/gifs/projecthailmary-waving-rocky-project-hail-mary-vP6B55t5F41koebdvO

[slow tinsel]

Its 6AM

Should i go to sleep or pull through

[fast isle]

go to bed

[plucky lark]

that's the website link from the search bar. i'm hoping its safe as i saw the site from a stream. And primeagen did a video on that service.

[slow tinsel]

Going to sleep now will equal in me waking up somewhere around 7 to 9pm

Pulling through till, idk, 2pm, would result in me sleeping to somewhere around 3AM if i'm lucky

[outer kiln]

this circled part is where he says he's god, which oddly has a caine type head shape

[slow tinsel]

I've got to work at 5pm tomorrow so both options REALLY suck

[outer sparrow]

ooooor what about having a debt.... with interest. Death: This months interest only payment is on i dont know....hmmm your left ball"

gets gangrene in left nut

[slow tinsel]

https://fixupx.com/zachbussey/status/2036849951657840700

Who couldve seen this coming

Zach Bussey 🇨🇦 (@zachbussey)

Trovo is shutting down its livestreaming service on June 30, 2026.
︀︀
︀︀It will instead focus on its gaming business.

**💬 60 🔁 68 ❤️ 378 👁️ 211.1K **

FixupX · Mar 25, 2026, 4:57 PM

[crude sleet]

yeah, I dont see anything

oh well

[slow tinsel]

Tek

Hows the scar on ur hand doing

[outer kiln]

huh...okay so I did a paulstretch on the full crashout part and now there's some symbol looking things in the spectrogram

hold on let me do it again

[outer sparrow]

why does this look like a beam of death punching through a city to me?...is it just me...no not just me ok...cool

[outer kiln]

I can kinda see it

[outer sparrow]

https://klipy.com/gifs/star-wars-death-star-5

[primal harbor]

1 5 2! ! | 53 1CB 1 1 8 ; ; 8 2

thats what i gleam from it

[near topaz]

Hear me out: the dnd spell revivify is just a magic defibrillator

Doesn’t have a material cost like all the other resurrection spells and can only bring you back from extremely recently dying

Pretty similar to an irl defibrillator

[outer sparrow]

what about an EpiPen?

[minor wraith]

argh <3 >.< hamlet is the best birb :D
https://www.youtube.com/shorts/_Spb96ShQiU

[near topaz]

Oh yeah if you’ve got an allergy in dnd I guess you’re just screwed

Wait hold up

Allergies are considered diseases

Yeah lesser restoration would cure allergies

[outer sparrow]

https://klipy.com/gifs/barney-simpsons-2

[near topaz]

It’s always funny to me just how absurd it is to be able to cure any disease with a level 2 spell slot lmao

No cost, just a spell slot

[outer kiln]

inverted colors on the spectrogram

[near topaz]

Especially considering in any given population in dnd 1% of people can cast 2nd level spells

[outer sparrow]

me: aw man i got cancer could you heal it. The jackass: i could but i would cost me a spell slot and i might need it during a fight

[near topaz]

Well yeah but 1 in 100 people can cast a 2nd level spell once per day

So like any kind of long term or severe diseases shouldn’t exist 😂

Might not be enough to go around to cure every cold n what not, but cancer and allergies yeah

[crude sleet]

oh wait

WAIT

THATS ACTUALLY GOT STUFF

[primal harbor]

i tired my best to clean that up

LC 5 E5 is what i read the ffirst 5

[outer sparrow]

why is BOB in there?

[fast isle]

hey chat can I get an opinion

[outer kiln]

the 5 comes in clear when it's in greyscale

[minor wraith]

my server annoyed the shit out of me for a long time, but i think i'd miss it now lols if it weren't running in the bg all te time lols. wutever part of the brain that equates to cuteness is associated with it, and when it run its fans up a bit, it's like 'aww, wut r u working on? :3' :P

[crude sleet]

that is a very defined 5

[fast isle]

should I play zombies or multiplayer on bo6?

[crude sleet]

and it almost looks like either a 25 or 29 next to that

[fast isle]

I can vaguely see a 5

[crude sleet]

and almost a 115 here

[outer kiln]

I paulstetched the area before that and it kinda sorta looks like the main cast

[fast isle]

zombies got it

[outer kiln]

this is the part where bubble is calling him unworthy and that maybe should be abandoned

[stone sierra]

Man I love waking up with a headache.

[outer sparrow]

creepy @fast isle

[crude sleet]

5 25 G 1 5 6 5 1 1 5 i i R

thats what I see

[near topaz]

https://youtube.com/shorts/rQlD9mWiaDk? fair bit overdramatized, but this is actually true from a few articles I’ve seen

[fast isle]

😂

[crude sleet]

errr, wait

[outer kiln]

this is where he says lets get this show on the road paulstretched, it looks like Kinger

[near topaz]

Are yall solving an ARG or something?

[crude sleet]

like, theres definitely something here

[left swift]

Man

[crude sleet]

its the caine crashout on spectrogram!

[left swift]

My stores gas price is so low

[near topaz]

Oh ep8 spoilers I see

[left swift]

In 26 minutes I got 325 in gas sales

[slow tinsel]

@crude sleet hows your scar on ur hand doing

[outer sparrow]

https://klipy.com/gifs/migi-parasite

is it fighting back?

[slow tinsel]

Idk all i know is tek london'd his hand like half a year ago

[crude sleet]

its healed, like, you can still see it, but its fine now

[left swift]

Tonight's already started being a rough shift

[outer sparrow]

lond..?

[slow tinsel]

Stabbed

[outer sparrow]

oooooh

[slow tinsel]

https://tenor.com/view/london-gif-19304239

[near topaz]

Hm hm ok so all new internet routers are banned in the U.S.

That’s interesting

[outer sparrow]

whaaaat?

[near topaz]

Specifically all that aren’t made in the U.S., which is all of them

Or nearly all of them, haven’t quite got a bead on if any are made here but I’m not seeing any yet lol

[outer sparrow]

dam and you guys thought gpus cpus and ram are pricey...just wait

[outer kiln]

??

ohhhh routers

[near topaz]

https://www.aarp.org/personal-technology/fcc-foreign-router-ban-explainer/

[outer kiln]

I read that as courses

[stark vessel]

https://cdn.discordapp.com/attachments/987123333659250688/1485937967712305152/go_2.gif

[hasty lagoon]

What the hell is that

[crude sleet]

https://cdn.discordapp.com/attachments/987123333659250688/1485937967712305152/go_2.gif

[hasty lagoon]

Gotta watch hail Mary sometime

[outer kiln]

TEK!!!!
I stretched the audio again and in the spectrogram there's Jax!

[crude sleet]

you havent watched TADC

[crude sleet]

YOOOOO

[hasty lagoon]

Nope ghost is on his way to my location to severely punish me because of this

[patent grove]

https://tenor.com/view/digital-circus-jax-digital-circus-tadc-the-amazing-digital-circus-smile-gif-17231608943546780181

[crude sleet]

@kindred kayak THERES SPECTROGRAM INFO IN CAINE'S CRASHOUT

[near topaz]

Yeah that covers basically every router brand you’ve heard of except starlink. There are a couple others but they are not well known at all or extremely expensive

[outer kiln]

look I'm gonna be honest, who knows if they're actually going to go through with this

they've tried banning other things then walked it back after outrage

[near topaz]

Looks like it already went though

https://docs.fcc.gov/public/attachments/DOC-420034A1.pdf

[primal harbor]

what if thats the previous abstracted members...

[outer kiln]

another Jax in the spectrogram

[near topaz]

Yeah as of 3 days ago on the 23rd

[crude sleet]

yall are at war right now. I wouldnt doubt it if most things are gonna be banned real soon.

[crude sleet]

POGGIES

[outer kiln]

this is very much a guy in the spectrogram

[near topaz]

We aren’t even at war tho, congress is the only ones who can decide that. The president is just doing his own thing but I won’t go into that further for obvious reasons 💀

[crude sleet]

no, it doesnt matter if he did it legally, he did it, and yall are at war

[outer kiln]

"illegal actions have legal battles to face"

[near topaz]

Oh yeah I meant legally

[urban cloak]

What even is it

[crude sleet]

but this is quickly getting into politics

and were gonna go back to talking about TADC now :3

[outer kiln]

scroll up to the guy in the spectrogram

[outer kiln]

a scifi movie about trying to find a way to save earth from discoveries in space

[primal harbor]

C
& R

[crude sleet]

FR

[primal harbor]

thats what i see

idk why

[urban cloak]

[primal harbor]

cause its C&A

[near topaz]

Ep9 spoilers

[outer kiln]

this looks like a drama mask

[near topaz]

Try messing around with the spectrogram more, you may be able to find settings that reveal more or make it clearer

[minor wraith]

chatting in chess leads to a loss to me every time >.<
it's like wtf you mean i'm talking to another human lols.. if i'm winning, i lose becuz i dun want them to feel bad >.<

[crude sleet]

like this?

[near topaz]

Idk man I’ve never touched a spectrogram

[crude sleet]

doesnt need spectrogram knowledge to know that that first bit is clearly a 5 😭

like, clear as day

[near topaz]

Well yeah but yall are looking at lot closer than the 5

[crude sleet]

it wasnt uninentional

[outer kiln]

another rabbit like figure

[primal harbor]

yeah but what does 5 mean in this context?

[crude sleet]

thats part of what we need to figure out

[minor wraith]

does glitch actually do that? have the historically left things in audio? o.O

[near topaz]

What if those are words?

[outer kiln]

could be partial code, could be something to do with an episode

[near topaz]

Behind a cypher or shift or whatever other form of encryption

[crude sleet]

would be interesting to go back and check. I mean, are there any other parts in the series where theres static or similar sounds?

[outer kiln]

these figures are only coming up from stretching the audio

[near topaz]

Maybe try getting Thor’s attention with it on stream tonight if he streams (he might since wasn’t able to for like 5 days lol)

He hasn’t seen it but he’s pretty experienced with things hidden like that

@edgy prairie TADC stuff is happening atm

If you’re up

[outer kiln]

this is what's really getting my attention, it's straight up a guy

looks like he's holding something also

maybe it has something to do with what caine said about the mind files? because we did find out that these are people that put on a headset

[clear bough]

💩👖?

[crude sleet]

maybe?

[clear bough]

🧠 ?

[outer kiln]

this part looks like people gathered around

[clear bough]

🧠 -> 🎪 ?

[outer kiln]

I think so

[outer sparrow]

https://klipy.com/gifs/da-vinci-2

[primal harbor]

the last supper

[stark vessel]

so its probably just a screenshot of the characters but put in audio

[primal harbor]

SAME

SAME JEZZA

SAME VIBES

I SCROLLED DOWN AND SAME BRAICELLL

[outer kiln]

hold on I'm gonna spectrogram the song caine sang

[minor wraith]

i hope to teach myself that humility is so much better than pretty much anything >.<

i have a problem with games where every opponent in ma brain is automatically the assholes that trolled me when i was a kid and it's all ARGHH MUST WIN AHH >:C>:C>:C

i refuse chats in chess.com all the time, and it's because i'm scared of being roasted for a stupid move... every time, it's just people wanting to talk >.<

[outer kiln]

okay yep I thought something might be here in the spectrogram
It already looks like something's here

[patent current]

Heyyyy chaaaattt!!! :3 UwU OmO UmU

[hallow sleet]

Hai

[primal harbor]

winter lurk

[minor wraith]

hiyo :D

[patent current]

Heyyyy wimbderrrr!!!!

[primal harbor]

[crude sleet]

maybe? It might be a bit more difficult, cause its during a music section, so there will be patterns that look like there might be something, but there isnt

[patent current]

Haiii wolpieeeee!!!!

[near topaz]

https://youtube.com/shorts/atjd8Xv999E?si=Q4uH7C6vJf59rWkf this is SO relatable 😭

[outer kiln]

true

[minor wraith]

hope you're having an awesome day :D

[hallow sleet]

I love the TADC fan base lol

[outer kiln]

Tek what does this look like to you?

[near topaz]

Matpat raised half of em apparently

[patent current]

I just woke up :3 so idk :3

[minor wraith]

haaha day to be determined, understood :P

[patent current]

Monke face? :3

[crude sleet]

MONY?

[minor wraith]

ma benefits ran out, and i'm not covered under ltd for some reason, so i watched ma bill go from 9 dollars to 114 :D
that royally sucked lol

[outer kiln]

and what about here?

do you see the solid 5?

in the middle

[outer kiln]

https://youtu.be/8ZYfwB6iC5Y?
episode 5's bar scene is important because it explores backstories

and pomni is 25

[primal harbor]

now that i see it

[outer kiln]

Jax said that he has lung cancer also

[crude sleet]

I see more numbers maybe?

try inversing the colours?

[primal harbor]

idk

maybe a stretch

[outer kiln]

no wait I see that

[subtle lance]

I think we're getting a red herring

[patent current]

Am I tripling, or there's two 5's? Tze really clear one, and another before. There's also a 3 at the end.

[crude sleet]

idk, this one might just be us trying to make sense of natural patterns in music

[subtle lance]

Hmm
Is there a separation of the lyrics from melody from drums?

[crude sleet]

I think that usually spectrograms are more apparent

[outer kiln]

if it is pointing to episode 5 it's the bar scene where they talk about themselves

[crude sleet]

like with this one

usually spectrogram info comes from static or weird sounding audio, which the crashout scene had a lot of

[outer kiln]

true

[subtle lance]

That's a good idea actually
Go run it

[outer kiln]

what other moments had audio like that?

[crude sleet]

that IS the crashout scene LOL

[subtle lance]

Wait the graph you posted?

[crude sleet]

YES

[subtle lance]

Oh.

Well I'll just sit over here and play some inscryption with the drywall

[crude sleet]

like, I refuse to believe that that spectrogram ISNT something more

and if there is spectrogram stuff here, I wonder if there is for the rest of the series too

[novel horizon]

What are yall doing?

[fast isle]

pic of moon from my phone

[novel horizon]

Some kind of arg?

[crude sleet]

TADC ep 8 spectrogram as a part of caine's crashout

[thorn ether]

I just realized I do the "are you winning son?" but to my husband.

I walk into his office for something and immediately ask if hes winning, regardless of what game hes playing

[plucky lark]

"Are you winning Homey?"

yes homey. as a reference to the simpsons

what marge calls homer

[subtle lance]

I feel like if there was, in this community, they would have found it already

[outer kiln]

I think there being so many 5's from EP8 is pointing to EP5, and also there being several Jax looking images from the crashout spectrogram means that it's for when Jax was talking about himself in the bar.
it's also mentioned that Pomni is 25

[crude sleet]

I mean, were nearly a week after ep 8 was posted, and this is the first time somebody has mentioned a spectrogram

[clear bough]

💩👖?

[thorn ether]

Jim!

[subtle lance]

Wait a minute
Is that an IP address

[thorn ether]

Hi Jim! I hope you are doing fantastic

[fast isle]

But what about 👖 💩 ?

[crude sleet]

maybe?

[clear bough]

💩👖.

[outer kiln]

could be

[subtle lance]

I think [the image] needs to be denoised somehow

[outer kiln]

Tek what other times has the audio been crazy like that in TADC?

[short totem]

hmm... would the evil version of JimDandy be DimJandy?

[peak willow]

hi jim!! always nice to see you

[crude sleet]

https://www.reddit.com/r/tadc/comments/1rzj2km/new_episode_8_theory_watch_before_readying/

[thorn ether]

Goblins! Earn glue snack rewards by making sure you get up & UNSHRAMP regularly, Hydrate , Have a snack OTHER THAN GLUE (preferably some fruit or cheese!) Do you have laundry that needs swapping ? How about tea ? Take your meds! Happy you're here ! Go make something awesome today . Proud of you, Love mom.

[fast isle]

I want glue

[thorn ether]

earn it

[outer kiln]

ohhhh okay okay this is gettin' really interesting, I think we're onto something

[fast isle]

damn

[subtle lance]

It's like
1.525.1.105.116.118
Or something???

[near topaz]

Just learned I can get some earbuds that aren’t either wired or over a hundred dollars so that’s awesome

[crude sleet]

so, who wants to plug that in? :3

[subtle lance]

Idk that's from me eyeballing it

[fast isle]

I got nothing lol

[outer kiln]

go for it

[near topaz]

Something about the shape of most earbuds hurts my ears, but the shape of apple’s are fine. So my options are usually their wired ones that are cheap and get destroyed if they get caught on anything, or spend a stupid amount on AirPods, but just discovered a pair that are wireless, that shape, and cheap so that’s awesome

[subtle lance]

Is that even a valid IP?

[outer kiln]

don't know

[subtle lance]

I'd be like iv6

[crude sleet]

nah, im good

[fast isle]

internet doesnt seem to think so

[near topaz]

I mean don’t think the IP matters without some other info to go with it

[crude sleet]

so like

this looks like 2 degrees

[subtle lance]

Could be a key of some sort

[subtle lance]

squints eyes
...69?

[crude sleet]

degrees seconds minutes

[fast isle]

caught a star with my zoom

[minor wraith]

zoomstar :D

[subtle lance]

Ohhhh

Oh
Oh no

[crude sleet]

52 Degrees, --- Minutes, 115 Seconds, R

[near topaz]

https://youtube.com/shorts/p90AIbT1mGo?si=4bQWhH32-nI9-Ui_ me tho

[crude sleet]

its DMS format

at least it looks like it

[subtle lance]

For coordinates.
[Expletive].

[stark vessel]

idk whats going on im guessing same as usual

[crude sleet]

so, this is an example of DMS

41°24'12.2"N 2°10'26.5"E

[subtle lance]

Istg if it's in freaking Norway

[mental canopy]

https://tenor.com/view/mmsf-starforce-star-force-luna-luna-platz-gif-9049082489928661717

I can't wait for the Star Force collection

OH WAIT

It's already out!

but I don't have the money for it...

[minor wraith]

lols i maed an asset. i hate it, but it exists, and can now point at stuff :D

[crude sleet]

wait

52 degrees S
--- Degrees E

115 i i R

no?

[patent current]

Battorshib :3

[minor wraith]

.<

[crude sleet]

it definitely looks like "52 Degrees" is that first part

[patent current]

Beeeg guns :3

[torn swallow]

https://tenor.com/view/bocchi-bocchi-the-rock-nijika-funny-chase-chase-meme-gif-8357110529661223254

[outer kiln]

the number 57 is important throughout the series, like ASCII 57

105 = 'i'
116 = 't'
118 = 'v'
Together: "itv" — potentially a fragment of a message or identifier

so what if the number sequence is ascii code?

[mental canopy]

honestly, I would appreciate it if someone would gift me one of the Mega Man RPG legacy collections for my birthday

but that's till june

[crude sleet]

looking at a smaller version of this, that end looks like theres a break, then 15 i i R

[outer kiln]

hmm

[stark vessel]

find it really funny that people attribute the circus falling apart to pomni joining like they didn't just lose a longtime friend at the same time

[fossil panther]

ALL THE TOEBEANS
enjoy, chat
https://www.youtube.com/shorts/sLYyPGEPKaw

[outer kiln]

I think we need to dive into more scenes with weird audio glitches like the one in the crashout, I think this is a end piece to a unfinished puzzle

[crude sleet]

52° 5 | S 1C i | 15 i i R

thats what I can make out

[outer kiln]

interesting

[near topaz]

That rare moment you happen to string together the perfect line of words like you just hit a random crit in tf2

Hm maybe I should go to the gym…. Just been letting that membership kinda chill for 3 months now 💀

[outer kiln]

I'm looking into something with a different episode please hold

[crude sleet]

https://tenor.com/view/please-hold-nope-dont-like-gif-25735045

[fierce imp]

bro the usgov has banned new routers that aren’t made in the us…

[near topaz]

Yup

Which is nearly all of them, minus starlink ofc

[winged creek]

e

[fossil panther]

guess those companies will have to rehab old or build new factories to hire people to build them here in the US if they wanna make more money...

[slim kraken]

US gov is absolutely insane for this (other things too lol)

What the hell is their reasoning

[winged creek]

i got a philosophy exam today...

[near topaz]

Security risk

[crude sleet]

cant see anything with this with how it is

[near topaz]

Basically the Tik Tok ban 2.0, except this one can’t physically stay for too long

[fossil panther]

we'll leave the speculation to servers where politics are permitted.

[slim kraken]

Meanwhile Starlink is global but Musk can shut it down whenever he wants, and has, for explicitely political reasons

U S A

[winged creek]

why is it so windy here-

[near topaz]

Yeah but can’t get into that here lol

[outer kiln]

looks like buildings

[fossil panther]

because bipolar spring lol

[slim kraken]

Yes kept it vague lol

[crude sleet]

maybe?

[near topaz]

Same when I brought it up earlier lmao

[winged creek]

wrong! Sulfuric acid! :3

[near topaz]

Aren’t we just two peas in a pod @slim kraken ? America and Canada

[slim kraken]

I will explicitely always be mad when governments restrict tech like this. In this instance, they are just showing their weakness and admitting how vulnerable the admin is

[slim kraken]

Yep...

[near topaz]

It’s just TikTok ban 2.0

There’s no real risk

[winged creek]

e

[slim kraken]

And in the end its their paranoid behavior that ends up being the real risk. Loss of institutional trust woth regards to public safety, if they cant even SUPPOSEDLY protect us from harm... with routers.

Again just using their own logic. Likely it's part of an authoritarian ploy for something or other. Some shit lol

[near topaz]

I bet spectrum stops offering free routers and replacements soon tho (that’s who my ISP is) 😭

[stone sierra]

https://tenor.com/view/oh-yeah-hell-gif-18853369

[outer kiln]

already existing routers will still be sold tbf

[near topaz]

Yeah but new ones are gonna get expensive quick

[near topaz]

I LOVE THAT

[slim kraken]

I dont think there's any silver lining here lol

That market will just spike in price now too

[torn swallow]

https://tenor.com/view/canada-goose-canada-united-states-eagle-canada-vs-usa-gif-2194413731579850637

[outer kiln]

I mean...all tech is getting more expensive

[slim kraken]

You know what? Real

We got cultural strength but overall we just copy the US

[near topaz]

The U.S. and Canada have the best relationship imo. Not politically since that rough at times, but culturally and how the actual humans interact lmao

[slim kraken]

Ok yes but this one has a line drawn specifically from high price to a newly and unfairly restricted market

[crude sleet]

test

[stone sierra]

Hytale update today!

[crude sleet]

weird

[near topaz]

Yeah I see a bit of a monopoly forming from SpaceX’s starlink if this isn’t repealed in a decent time. Not a total one ofc, but their sales are gonna skyrocket since they are by far the most well known brand that is still allowed

[fossil panther]

What if YOU'RE weird?

[slim kraken]

The US admin is allergic to anything now that might comprimise their spy network, which I guess includes routers now alongside tiktok lol

[slim kraken]

100%

[near topaz]

Oh shit like the real one and not a pre release?

[stone sierra]

should be the public update, yes

[near topaz]

[slim kraken]

Has nvidia started onshoring into the US?

[outer kiln]

dunno

[near topaz]

Highly doubt it, making things in the U.S. is usually a bad idea from a profit perspective

[slim kraken]

I can see Jensen hopping onto this if he can

[slim kraken]

Yeah the production costs make the end price massive

Still this is their plan, as dumb as it is

Like trying to get Apple and Intel to build in the US lol

[near topaz]

I am curious who will start producing routers in the U.S. now vs who will just ignore the ban and keep serving the rest of the world

[slim kraken]

BLACK MARKET ROUTERS

[stone sierra]

Update 4 launches next week, March 26th! If you're running a server or building mods, this is your last pre-release window. Test your plugins and get everything ready for…

— Simon (@Simon_Hypixel) March 19, 2026

[slim kraken]

I just want linux support for the creative tools lacking it atm

Then my soul is theirs

[stone sierra]

which one don't work on linux? i'm guessing blockbench

[outer kiln]

I think they're gonna end up walking it back, people just gotta get mad and complain enough
that's just me tho

[near topaz]

Oh hey you do art right?

[stone sierra]

which is funny, since BB works on macos

[slim kraken]

Blockbench works. Its the asset node editor for one

A few others but I forget

But that is the big one

[slim kraken]

Ye

[outer kiln]

happened with tiktok

[near topaz]

Think I saw earlier Krila got like a massive update including Linux support

[stone sierra]

i think the aset node editor works on macos. Unsure which one that actually is, tho

[near topaz]

Idk if you like that or not but seems possibly relevant lol

[slim kraken]

Krita worked well enough beforehand from what I understood

[stark vessel]

what distro and what art stuff you looking at? there might be some technical stuff you can do to get things set up

[thorn ether]

Kirta has always had fairly decent Linux support

[slim kraken]

I downloaded Krita the other day but havent tried it out yet

[thorn ether]

its one of the few PS alts that did

[outer kiln]

they're getting an update soon (dunno if yall already talked about it or not)

[slim kraken]

Its been on flathub for a good while yeah lol

[stone sierra]

this is how Macroslop "fixes" bugs, right?

[slim kraken]

SteamOS and right now just Hytale's asset node editor. I can likely just run it in wine

But aaaa I dont wanna bother lol

Waiting for official support

[thorn ether]

yup! we've got it on the mini lunix box we set up for my kid when she was younger. It's always been a really good alternative for drawing/photoshop alternative and it supports a bunch of different OS.

[uncut ermine]

Chat I have news

[stark vessel]

https://tenor.com/view/big-news-bullish-bullish-af-crypto-fantastic-gif-16753036148370554223

[uncut ermine]

The new tomadachi life game has no filter

[slim kraken]

I downloaded it thinking I was about to buy a drawing tablet but I changed my mind. Still, I got a MUCH OLDER tablet I can still use, might play around with Krita later

[thorn ether]

Krita is great. I use both it and CSP

[slim kraken]

I also saw for GIMP someone made an interface mod so the keybinds and functionalities are akin to Photoshop. Cause I used to do a lot of photo manipulation in PS

Unsure if Krita can handle that too but either way I can use both

[outer kiln]

Krita is my main go to art program

[thorn ether]

Krita is a nice lightweight free alternative to CSP for those who want something closer to PS, but dont wanna spend $$

[slim kraken]

Def gonna play around with it later then

[thorn ether]

they also adhear to the open source ethos which is always a huge + in my book.

[slim kraken]

I finished a drawing yesterday I wouldnt mind going over digitally, so perhaps there's a project there for me

[thorn ether]

https://fixupx.com/MrFoodies/status/2036938198434390249?s=20

Foodies (@MrFoodies)

Monster Energy Cake? 😳🎂
︀︀
︀︀Eat or Pass? 🤔

**💬 18 🔁 37 ❤️ 230 👁️ 24.2K **

▶ Play video

FixupX · Mar 25, 2026, 10:48 PM

https://giphy.com/gifs/cbc-schitts-creek-dB12mOQb99BwDlM83I

thats the face I made when I saw that

[short totem]

wait, its thors birthday? i don't think he will like that flavor of cake...

[thorn ether]

no, thats clearly a cake chat would eat.

[outer kiln]

this is from when caine was abstracting and was yelling "what do you freaks want from me" in EP8

[crude sleet]

yep, more numbers!

57582

[short totem]

is chat real or are they cake?

[outer kiln]

https://tenor.com/view/damseldistress-gif-21420919

[minor wraith]

i play and play and play, and then chess.com is like you play a lot... and i'm still THE SAME FKN ELO :D
i gotta learn theory :(

[distant iron]

hes like 74 right

[thorn ether]

his back thinks he is

[distant iron]

felt that one

although i shouldnt have funny a posture when working from home

lmao

[thorn ether]

do i need to tap the sign

[minor wraith]

thor is a march bday? o.O

[thorn ether]

no

[short totem]

yes, it is always his birthday. as he is the all mother

[stark vessel]

i thought he was 67

[minor wraith]

:/

[thorn ether]

https://giphy.com/gifs/showtime-hbo-prime-puOukoEvH4uAw

[distant iron]

i wouldnt mind if you dropped dead

[short totem]

its also because he is always in a time loop, but we don't talk about it.

[manic widget]

Is this server about 🏴‍☠️games ?

[minor wraith]

memes used to be fun, but it seems like they feel more and more like existing in an asteroid belt. is this getting old? :'/

[thorn ether]

#piracy-requests

[slim kraken]

Rude Yuko!

[distant iron]

he wants literal pirate games

[thorn ether]

we just point em to the channel

if they can read, they figure it out. if not we ticket.

[distant iron]

It was a 6-7 joke i was justified

[minor wraith]

sea of thieves would be right up your alley :D

[manic widget]

Wrong server

Im on my rebellious act

I shall leave

[stark vessel]

https://tenor.com/view/no-no-point-kronk-gif-13896471

[minor wraith]

or maybe the perfect server o.o

[manic widget]

Fair well my dear comrades

[stark vessel]

yeah it was a bit of a low hanging fruit lol

[manic widget]

Seeing the rules this isn’t my place

[slim kraken]

And you took it

[minor wraith]

nuuu you don't know wut you're missing

[slim kraken]

Proud of you

[thorn ether]

You can always stick around, we just dont do the piracy thing here.

at least not the software kind.

now if boats and rum are involved..........Yarrrrr

[manic widget]

Rum

I like

[minor wraith]

one of us one of us

[manic widget]

Wanted to go down the dark path yet found light

[distant iron]

lmfao

[minor wraith]

right here

:P

[thorn ether]

[minor wraith]

this place kicks ass ftr

[slim kraken]

https://tenor.com/view/higurashi-higurashi-when-they-cry-hanyuu-hanyuu-furude-gif-15978648489512215783

[stone sierra]

https://tenor.com/view/use-as-required-use-when-required-can-whoop-ass-gif-15932040

[stone sierra]

https://tenor.com/view/claymore-roomba-gif-1801248922901101280

88%.

now get out of my walls

[thorn ether]

we have that as a plushie somewhere in this house

[stone sierra]

Hi Mirror

[slim kraken]

The insulation tastes good so no

You got the good brand

[minor wraith]

is that a claymore on a roomba

[stone sierra]

I have the real thing.

[slim kraken]

O I seen that. I want one lol

[stone sierra]

we... we don't have those matchstick walls here. We have solid concrete.

[distant iron]

you forgot to backspace for clean rows

[slim kraken]

Mmmm conkcrete

[stone sierra]

Yes. Yes it is.

[slim kraken]

Yum

[stone sierra]

99.8%.

[slim kraken]

Crumnch

[stone sierra]

I cast: 100% rasin donut.

[thorn ether]

its a single row on my screen

stop viewing it on a casio calculator watch from the 80s

[slim kraken]

Ur a raisin

[stone sierra]

nope. you are.

[distant iron]

sorry im still using a blackberry

[stone sierra]

you're literally 100% raisin.

[mental canopy]

https://tenor.com/view/hong-lu-limbus-company-limbussy-limbus-limcom-gif-12096551780678179202

[slim kraken]

U

[stone sierra]

EXtraRaisin

[slim kraken]

Rev Silverstein

[stone sierra]

https://tenor.com/view/rosebrew-tankard-beer-tavern-brawl-stormforged-gif-20708794

[slim kraken]

https://youtu.be/Npw83slFZwk?si=8irt5rUYnNpg9a6V

[stone sierra]

i ain't watching that

yo, Blue

[slim kraken]

100% u should

[distant iron]

oh boy

[stone sierra]

I'm at work.

[slim kraken]

OH OK FAIR

Show your boss

[minor wraith]

i dun even know what to think about that lol. that would be terrifying >.<
especially in a confined space. it'd be the worst mental debate over whether it'd be better to stop the roomba or try and get away from it x.x
especially with the random turns that they do as they go through their route o.o
i jus have this image in ma head with a happy little roomba cruising around with a claymore wildly waving around lols

[distant iron]

fnaf jumpscare LMAO

[patent grove]

Rev’s boss would probably be confused

[stone sierra]

my boss is like 400km away and I stopped giving a raisin about this job. Next Tuesday's my last day. I'm just here wasting power and playing HSR while I doomscroll reddit and fart around Discord

[wise wedge]

Heya i have been finding the ancient memes with context so i can teach the youths about where sound bits and other common elements come from

[slim kraken]

Ok god damn it thats funny

[distant iron]

at least the first scream

[stone sierra]

https://tenor.com/view/bullish-bullish-af-buy-buy-moar-crypto-gif-4023638677059070706

[slim kraken]

Face cam action

RRRAAAAAAAA

He screamo's an angry response to Simon at the end

[distant iron]

oh my god thats funny

[wise wedge]

Example of the classic manic kaboom sound effect

[stone sierra]

i ain't watching that either

[distant iron]

THERE WAS MORE TO IT????

WTF

[stone sierra]

there's always more to everything.

[slim kraken]

Holy shit I gotta cut my hair

[distant iron]

i got you

[stone sierra]

including EXtraRaisin. There can be raisin sprinkles on EXtraRaisin.

[distant iron]

snippy snippy

[stone sierra]

https://tenor.com/view/mowing-lawn-cutting-grass-gif-6160555

hold up, i'm getting the mower started

[slim kraken]

My gf has haircutting scissors already + I dont trust u, ur gonna give me a tonsure

[distant iron]

i know how to style hair buddy

[slim kraken]

Oh neat

[distant iron]

trust me i used to be professional

[stone sierra]

I was unaware raisins could have hair, tbh

[distant iron]

[slim kraken]

Oh thats cool

Oh

She laughs

[frozen dew]

I mean you can be a professional in anything and say "I used to be a professional"

[slim kraken]

She's giving me a tonsure god damn it

[frozen dew]

could have been a competitive eater

[distant iron]

well

i did it a lot with my own hair some years ago

[stone sierra]

could be a professional pain in the butt. Like Alpha

[distant iron]

how hard could it be on someone elses

[slim kraken]

I really just need to trim it down cause its super long. Aint got funds for a nice style lol

[wise wedge]

Yep thats the full context of the sound that was then made into a meme isn’t history grand

[slim kraken]

If I had the funds and we didnt live in SUPER RURAL ONTARIO and had more reasons to go out, I'd probably style my hair more frequently

Im just content keeping it out of my eyes and in the summer, keeping bugs out of it lol

[distant iron]

hick donut

[slim kraken]

GELP

[stone sierra]

we found the degen from upnorth

[wise wedge]

This is the original meme that used the sounds together in the format we are used to https://www.youtube.com/watch?v=5EHtRH7Rilo

[near topaz]

2am gym is the best time to gym

Like 3 people here lol

[stone sierra]

https://tenor.com/view/ferda-letterkenny-hockey-gif-10931977

2 of them are them

[frozen dew]

3? that's 3 more than I'm comfortable with

[slim kraken]

Best part is, this rural section of the north is actually really progressive and at least the voter base that wins doesnt see my trans ass as something to fear

[near topaz]

Massive ahh gym tho

[wise wedge]

Also saw a old old chuck norris meme and i was happy to see it so well preserved

[slim kraken]

Its nice actually, knowing people got your back even if queerphobic shitheads still exist

[minor wraith]

....i just resigned a game because firefox asked me about allowing notifications. the popup covered the top half of their piece on a4. i thought it was a queen, and i thought i screwed up majorly... it was, in fact, their king >.<

[slim kraken]

I dont mind the bugs, even. OK I DO, but not to the point of relocating

[patent current]

You mean a Shark was involved in a Chuck Norris attack?

[wise wedge]

Back when photoshop/recomposition was the main way to show off falsehoods as real

[slim kraken]

Turn up contrast. LOOK, ARTIFACTING

[wise wedge]

Chuck norris did attack a shark so it was technically a shark attack, yea.

[frozen dew]

I'm legitimately gonna go to the gym at like 4am

[wise wedge]

Also photo grain difference

[frozen dew]

just to avoid people

[wise wedge]

That ones fun

[near topaz]

Well I’d say that didn’t go terribly

[patent current]

But shark is not the one to attack, Chuck Norris is the one to attack shark :3

[wise wedge]

Now its pixel encoding density

[wise wedge]

Yes but both attacking and being attacked by something is called an (blank) attack. 🙃 grammer is fun when it makes sentences make less sense following the rules.

[patent current]

I've never heard it said like that.

[wise wedge]

Cause technically the actual meaning of (blank) attack is an attack involving the subject that is that blank cause a day attack isnt the daylight or daytime attacking

The shark was involved in the attack and lost against the might that is chuck norris

[wise wedge]

Congrats

[near topaz]

Thx, I already can’t move my arms certain ways

Tomorrow gonna hurt

[slim kraken]

Shark encounter

Surf themed rpg music starts

[patent grove]

https://tenor.com/view/get-rotated-get-rotated-idiot-rotate-rotation-shark-gif-24511062

[distant iron]

the fabric store employee after catching me eating all the glitter

[wise wedge]

Encounter could mean it was amicable and i can assure you chuck norris was not

[slim kraken]

https://tenor.com/view/cirno-cirno-spin-touhou-gif-25136419

Rotate

[distant iron]

yeah i forgot the store name

[slim kraken]

You GOBLIN

[uncut ermine]

Mmmmmm glitter

[wise wedge]

https://tenor.com/view/puke-glitter-puking-glitter-gif-5922448

[distant iron]

dont judge me for my malnourished ass eating whatever

i tried to keep up with beauty standards

[slim kraken]

Listen I have dreams of eating plastic

[wise wedge]

Also glitter as a vomit censor in a movie seems very good

[near topaz]

I love being out at night, it’s so free

Barely anyone else out in the large city

All the lights turn green instantly

[mental canopy]

https://tenor.com/view/touhou-cirno-fumo-i-am-going-insane-gif-1063292303825937284

[slim kraken]

Ppl used to put a lot of pressure on my gf to do the same. It sucks and its dumb

[mental canopy]

good lord, I feel like going back down the touhou rabbit hole

[slim kraken]

Do it

[near topaz]

Lmao I see what’s wrong with that link lol

[distant iron]

im still horrifically skinny

were working on it

[mental canopy]

Also I feel like showing off my boyfriend's first piece of art of his fursona

[slim kraken]

That's good, a little bit at a time

[near topaz]

https://youtu.be/owWPgg2yF00? found a banger to add to my playlist while at the gym, sometimes there are some great songs on. This one is super pretty

[patent grove]

Epic apparently paid the rock $15 million for his appearance in Fortnite

was it worth it?

[slim kraken]

1000+ laid off employees say no

[near topaz]

Damn he’s good

[patent grove]

I think

Tim should be fired

[slim kraken]

Replace Tim Sweeney with Tim Allan

[near topaz]

Tim was campaigning for steam to remove its ai disclosure, this is not new lmao

[stark vessel]

femboy 🫵

[near topaz]

He should have been gone long ago

[slim kraken]

The lesser of two evil Tims, Tim Allan

[stark vessel]

looks cute lol

[patent grove]

Tim looks like a lizard wearing a human suit

[mental canopy]

I did tell him that I wish I had a piece of art as cute as that

[patent grove]

I got Follie

[slim kraken]

Farmed or bought

[patent grove]

She’s currently in the foundry

[slim kraken]

Oh ok

I heard the new follie's hunt gamemode kinda sucks

[mental canopy]

it's BRUTAL

[patent grove]

I might spend the 50 platinum to rush her when her parts are done later today

[mental canopy]

even on non-steel path

[slim kraken]

Im redownloading just for the survival changes ngl

[patent grove]

I only need the Enkaus blueprint

[patent grove]

And I’ll have her rifle

[wise wedge]

Did they make 15 million in increased sales on their cosmetics during the event

[patent grove]

Y-You uninstalled it?

[slim kraken]

Half a TB drive so yes

[primal harbor]

https://tenor.com/view/post-this-cat-disco-cat-bounce-but-here's-the-jumper-one-time-gif-703903172250378112

[patent grove]

Oh

[patent grove]

DOKI

[mental canopy]

along with my daily affirmation of how much I love him

which is ALOT

[minor wraith]

wow puzzles really do help tho >.< i almost saw the same position in a puzzle lols

[slim kraken]

I play very infrequently so its uninstalled when not currently playing. I get bored, install it again when a new update peaks my interest again

Tbh Warframe doesnt excite me like it used to

[patent grove]

I saw people saying destiny 2 is doing better than Warframe

it isn’t.

[mental canopy]

i doubt that

[slim kraken]

Yeah insane statement

[mental canopy]

they are lying out their ass

[slim kraken]

These days im just kinda floating between a few games but have not found anything that stands out and becomes my current obsession.

Grim Dawn comes close tho

[patent grove]

I have grim dawn

Haven’t installed it yet

[near topaz]

Chat help am in pain, muscles already sore… I forgot to eat earlier oops

[brazen ivy]

you mean when all resources were vague and hard to see on the map, when warframe mods took up slot plots, when melee was only press e, when all the bosses were in one of 3 tile rooms and could die before their intro, when mods didn't glow, when you had orkin keys that were a weird ass logo arch, or when the map was like 9 planets and no moons

[slim kraken]

Its so good. It has become my go to for doing hardcore challenge stuff

[patent grove]

Listen here you

[brazen ivy]

also there was no ordis or running around it was just a hud

[patent grove]

https://tenor.com/view/goose-honk-inhale-inhales-untitled-gif-16237480

[brazen ivy]

https://tenor.com/view/spongebob-barnacles-gif-27349480

[patent grove]

https://tenor.com/view/spongebob-sandy-i-heard-that-gif-16413922558163282726

[slim kraken]

ROFL yeah im nostalgic for the good ol days of zoren coptering /j

I just got bored of being OP all the time as of late. Game feels solved or otherwise like I am just chasing sidegrades or very minor upgrades, in a game that numbs my brain playing it.

Fun but it isnt holding my attention when I can otherwise go play another game where I mow down large crowds of enemies but I feel like progression matters more

[shell plover]

https://fixupx.com/Dexerto/status/2036881039159615677?s=20

Dexerto (@Dexerto)

Twitch has announced new rules and security protocols for TwitchCon including:
︀︀
︀︀- Reservations required for meet & greets
︀︀- No walk-ups at meet & greets
︀︀- Additional staff for meet & greets
︀︀- Investing in more security

**💬 67 🔁 58 ❤️ 1.2K 👁️ 82.4K **

FixupX · Mar 25, 2026, 7:00 PM

[brazen ivy]

i think its just because they pretty much did what they could with the engine, and now they've created so much fluff on top of the system like operators, railjacks, openworld maps, archwings, flying the ship, mastery systems, that weird ass skateboard thing, hunting, fishing, the codex scanning, pets, ordius, the bio-room in your ship i think it just got lost in the sause

[slim kraken]

Different kind of game, but

I really want to get into Vintage Story, but the high level of danger and complicated and involved systems are very daunting.

And my gf is uninterested in playing it so lol, gotta either comit to singleplayer or find a goos mp server

[winged creek]

wall

get wall'd idiot (/silly)

[slim kraken]

Pretty much. Also after several thousands of hours I got my fill lol

[near topaz]

Wow that’s nice

[brazen ivy]

gotta make my own game thats going to take me 5 years

[slim kraken]

I see this and know Dan is gonna ruin it somehow

[brazen ivy]

https://tenor.com/view/british-cop-screaming-screaming-sad-gif-10576833416044093400

[slim kraken]

WE GOT SECURITY
(Streamer gets harassed anyway)

[slim kraken]

Yeah fr?

[patent grove]

Chat

[slim kraken]

U makin the next big bounce house shooter?

[patent grove]

I had a cinnamonnin roll

[slim kraken]

Its 4am

[patent grove]

So?

https://cdn.discordapp.com/emojis/1175591565729734756.webp?size=48&animated=true&name=Plink&lossless=true

[slim kraken]

Fair, carry on

Lol

[patent grove]

Breakfast!

[slim kraken]

Honestly after trying for a while

Idk how people can do super sugary stuff for breakfast

[patent grove]

I’m probably gonna make chicken fajitas today

[slim kraken]

Yumm

[brazen ivy]

yeah because its procedural generated racing basically need for speed but with fake part brands, customization, police chases, and random races in real time which is going to be a huge pain in the ass

[slim kraken]

Sounds neat

[outer kiln]

sounds fun af tho

[slim kraken]

I had to rewrite those two words way too many times

I wrote spund sneat at one point

[outer kiln]

haha

[brazen ivy]

it's pretty sneat

[outer kiln]

Donut you sound tired

[slim kraken]

Yes woke up cause abdomen pain and waiting for it to die down before laying back down

[brazen ivy]

its funny that world generation doesn't really phase me, but car controls and getting the feeling sure does because racing lives and dies by feels and controls

[slim kraken]

100% if a game's car controls feel like ass it is immediately ruined. And its so easy to mess up

Good luck

Dont make reverse ramp up in speed infinitely

[patent grove]

https://tenor.com/view/kirby-drive-pokemon-fast-gif-11369052

[slim kraken]

https://tenor.com/view/youre-winner-winner-win-big-rigs-over-the-road-racing-gif-15745630

[near topaz]

Man I’d really like to make a game, possibly even with someone else, but I just can’t physically acquire new skills till I figure out how tf to deal with this depression thing

[primal harbor]

AAAAAA

AAAAA

[near topaz]

Same

[primal harbor]

i rewatched the begining of ep8 of tadc

[frozen dew]

AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

[slim kraken]

I have no patience for it I found. I'd work on a game if it meant asset creation or writing but thats about it

[brazen ivy]

to be fair depends on the car combustion engines are why cars kinda get stuck at the 30-40 miles per hour reverse

[primal harbor]

THE RED CIRCLE IS CANE
THE BLUE CIRCLE US BUBBLE

[brazen ivy]

the fastest car to go in reverse was at 171 mph

[outer kiln]

I've been thinking that for a while ngl

Bubble clearly understands things more than he lets on

[primal harbor]

Caine consumed bubble

[uncut ermine]

ITS SO CUTE

[near topaz]

Any EDM enthusiasts in chat atm?

[patent grove]

Chat

[outer kiln]

yo

[patent grove]

My elder cat is trying to snuggle against me

Help

[near topaz]

https://youtu.be/owWPgg2yF00? know any songs like this? I love how pretty it sounds

[brazen jewel]

I can get down with some EDM.

[patent grove]

Callista is a good EDM track

https://open.spotify.com/track/1VZmnbUDufA9I3UbFAnVwo?si=3cJo2EMqTtKKR6mcuU1cEg

It’s the music playing in Afterlife on Omega in Mass Effect 2

[outer kiln]

https://youtu.be/NjpGBAnKHIg?
not exactly the same but ATB is pretty good

[near topaz]

Oh I fwt

That’s really good

[outer kiln]

https://youtu.be/nqvLvPwBN0M?

also AR/CO

[outer kiln]

legit I feel like they only do feel good tracks, I love it

[slim kraken]

I watch 1 clip of Boardwalk Empire, algorithm feeds me more

God damn it. Time for a rewatch

[outer kiln]

Noah Edwards also does fun remixes

[alpine pike]

Hyper Bird?

[near topaz]

Dance bird

[outer kiln]

https://youtu.be/VVG2l9opMQQ?

[alpine pike]

https://tenor.com/view/hyper-sonic-sonic-the-hedgehog-gif-19890232

[outer kiln]

Sonic the ALLHedge

[outer kiln]

https://tenor.com/view/yes-gif-18753628

[near topaz]

Coincidence? I think not

(Yes you can ride a roomba in oneshot)

[outer kiln]

I love tails so this makes sense

[near topaz]

Tails is the GOAT

[alpine pike]

Tales is a pun for being fast

[outer kiln]

Miles Prower

[alpine pike]

Tales Miles Prower

[near topaz]

Favorite (canon) ship ever

[alpine pike]

Miles per hour

[alpine pike]

And yet it died with that filler

[near topaz]

EKCMELWPWLFMRIWIWNRNFNKSMEMFIW

RAGE

[outer kiln]

they don't let tails have anything fr

[near topaz]

LITERALLY HAD HIM SHOOT HER

IN A KIDS SHOW

[outer kiln]

they're like "YOU EITHER SCINCE BOY OR YOU EVIL SCIENCE BOY"

[near topaz]

If tails became a villain nobody could blame him

[alpine pike]

At least Tales had an evil persona in Sonic Prime

[outer kiln]

his evil version is like reverse flash

[near topaz]

Haven’t seen that one, like as smart and always a step ahead?

[kindred kayak]

WAIT FR,

[alpine pike]

It was basically, what if Sonic was never there to help him

[kindred kayak]

YOOOOOOOOOOO

[near topaz]

If so, that’s hella valid. Tails is always clowning on eggman, he’s absurdly smart

[outer kiln]

a legit guy in the spectrogram

[kindred kayak]

he chillin

[stark vessel]

https://cdn.discordapp.com/attachments/592597586263932932/1378821576769671208/flag.gif

[outer kiln]

he looks like he's holding a mini kinger the more I look at it

[near topaz]

When the world needed matpat most moment

[stark vessel]

tried to work out, but it seems i need more carbs

[outer kiln]

this is just straight up jax in the spectrogram peeking at us

[stark vessel]

guh

[near topaz]

I also tried to work out. Went well, however my body has informed me I forgot to eat today

So uh

Yes.

[alpine pike]

Or, maybe you are just seeing what you want to see

[stark vessel]

hate when my body feels tired but not sore

[near topaz]

That’s not how this game theory stuff works, you propose other theories, not shut them down

[stark vessel]

like, i should be doing more but my body just cannot even tho I haven't pushed myself

[outer kiln]

mayhaps

https://www.twitch.tv/theburntpeanut/clip/GleamingThankfulOryxMau5-YPJCHMtn2-NhJ4_y

[alpine pike]

Hypothesis are given, for it to be criticized and see if it can be kept up to it's hold on reality

[near topaz]

Fair ig

[alpine pike]

That's how any hypothesis hold it's ground to become a theory

[outer kiln]

mhm

[fast isle]

have a space pic (I couldnt get who took it)

[stark vessel]

space pride flag :3

[near topaz]

An observatory if I had to guess

[outer kiln]

either way it's very interesting to find stuff in a audio file.
even if it leads to nothing it's interesting

[alpine pike]

Has a 3D effect on it

[fast isle]

lemme look for the person who made it

[stark vessel]

it doesn't seem like the kind of show to have anything hidden in the audio file but it's still worth a look ig

[outer kiln]

Tek is the only reason I started looking ngl

[near topaz]

I mean Minecraft just put out an AGR so like anyone could ig

[alpine pike]

I refuse to acknowledge that an AI (automation) took the picture

[fast isle]

found the source

[dense nova]

Sus, i dont have any mutual servers or friends with them

[outer kiln]

using a real life pic on discord?
DANGER DANGER DANGER

[alpine pike]

Mr Chicken, you seem to either be popular or a target. Either way, you are sought after

[fast isle]

its def a bot

[near topaz]

Doesn’t address the issue

[outer kiln]

well that bot is polite at least

[near topaz]

Do the recipe thing

[alpine pike]

Yeah, but it reeks of dead internet theory

[fast isle]

https://www.space.com/veil-nebula-photo

[dense nova]

Right as i typed that out you suggest it

Lmao

[outer kiln]

if life were a simulation I would exist...wait

sorry chat

[fast isle]

also this
https://waid-observatory.com/ngc6960-2017-06-30.html

very cool pic though

looks nice

camera go brrrr

[outer kiln]

Space is so cool and dangerous and magical and scary

[near topaz]

https://x.com/ultima_undead/status/2036553078564950496?s=46&t=1_gFjP0iEIRpxRpHu4okhg

Ullltimaaaaa🍉🇵🇸 (@Ultima_Undead)

We laughed at him…
We belittled him…
We shouldve praised him…

▶ Play video

X · Mar 24, 2026, 9:17 PM

[fast isle]

real. we have all these pictures of galaxies and stars and all this stuff, yet we don't know whats actually there

[outer kiln]

music came in and I couldn't understand him

[alpine pike]

My background picture:

[outer kiln]

we do know that there's pockets of liquid out there and it can cause distortions in pictures

[near topaz]

I mean I’m not watching to avoid spoilers, but felt worth sharing since apparently he predicted something and there’s a bunch of theorists in chat today lol

[fast isle]

epic

[alpine pike]

Comes with COSMIC Desktop.. the irony is not lost on me

[fast isle]

if you want some seriously good pics, check
https://www.nasa.gov/images/

[stone sierra]

Kubrick did good work

[fast isle]

?

[stone sierra]

r/woooosh?

[fast isle]

who/what is kubrick

lol

[stone sierra]

https://en.wikipedia.org/wiki/Stanley_Kubrick

[alpine pike]

"That's one small step for [a] man, one giant leap for mankind."

[fast isle]

I have no idea who that is lol

[alpine pike]

The guy that shoots

[fast isle]

https://www.flickr.com/photos/nasawebbtelescope/

[outer kiln]

he's the guy people say used CGI to fake the moon landing

[fast isle]

oh my god moon landing deniers piss me off so damn much 😂 😂

we went to the moon 6 F'ING TIMES

even russia said we went

[outer kiln]

also the first instance of movie quality CGI was in 1973 for Westworld....Westworld does not use the type of CGI people say was used to fake the moon landing like at all

[fast isle]

we didnt invent all this technology, documentation, and training for nothing???

[dense nova]

Hmm

[dense nova]

I mean, it was faked but Stanley Kubrick was such a perfectionist that he insisted on shooting at location

[torn swallow]

You got a random friend request?

[fast isle]

to say the moon landing was fake also implies that the thousands of engineers, doctors, pilots, programmers, and scientists were in on it
I hate moon landing deniers lol

[fast isle]

camera man never dies

even on the moon

[weak vessel]

makes sense to me
I mean
who else do you get in to shoot your moon landing footage at the time other than Kubrick?
no-one that's who
they had no choice, they had to get the main main in for it

[dense nova]

https://tenor.com/view/dune-1984-shield-gif-18397416

[fast isle]

and its not even a political thing, its just people being dumb

[dense nova]

Yeah 😅

[weak vessel]

ngl I would watch David Lynch's Moon Landing

[outer kiln]

Westworld was 2D pixel manipulation (animation on film), the very very first instance of CGI wasn't even like that it was animated text in the movie Vertigo.
then the next instance was 2001 a space oddity which used 2D wireframe animation that again was animated on film not actual computer generation.
really the CGI that was being used was 2D animation, this didn't change until 1976 in the movie Futureworld

[edgy storm]

What even is the point of denying it there is nothing to gain from denying the moon landing

it happend cmon people

[fast isle]

no idea lol

[steady vector]

saw ants crawlin'

[near topaz]

Istg this artist’s reactions to being accused of using AI is the best

[outer kiln]

https://tenor.com/view/future-world-movie-trailer-gif-20204667

[outer kiln]

and that's it right there, mostly live action with some 3D, that's the most it was able to do

[alpine pike]

Assuming the artist knows how to train the AI, and that it doesn't have access to the internet. And those are a lot of bumps as it should also be tested

[near topaz]

What?

[alpine pike]

I believe Final Fantasy 7 was inspired by this

[outer kiln]

but suuuure the moon landing was 3D cgi from Stanley Kubrick who was doing 2D WIREFRAME ANIMATION

[alpine pike]

Well the image infer that the artist trained an AI, as an automation skill

[outer kiln]

possibly, Futureworld inspired a lot of scifi

[near topaz]

No, it’s inferring the ai stole their art, like it’s done with endless creators online

It’s them bragging

The whole scrapping the internet for training materials thing

They’re against ai

[novel horizon]

You do gotta feel bad for the artists that AI used as training material. Now they get accused just because AI is copying them

[alpine pike]

One can always train your own LLM on your own material though, which could create a kickstart of your art.. where the artist fills the rest

[near topaz]

And their high quality art predates ai as their account is from over a decade ago

So they definitely have the skill

[novel horizon]

I know some splash artist at riot was hounded by AI accusations

I think

it's been so long

[alpine pike]

Nah, because arguments can be made to satisfy the strength of the artist

[outer kiln]

League art has been ran through ai for uh...specific reasons

[near topaz]

Yeah that’s why everyone is pissed at Gen ai

[alpine pike]

I mean Artist on a company gets underpaid

so obviously to automate the developing of said project, they use AI

But people neglect the difference in intent of the usage of AI

And just merge everything into one bad thing