Plugin Help chat
#minecraft
fallow nova
drifting thistle
Nothing worked :/
severe drift
A hacker made the mistake of sending me their .minecraft folder
lol it was full of screenshots of them hacking
cedar bramble
๐
slow imp
๐
severe drift
Possibly the worst hacker to exist
slow imp
:))
I don't want to lost my rank cause a kid who doesn't have thoes 7 years from home
If u know what i mean
severe drift
teh grammer is not exist
cedar bramble
๐
slow imp
Ignore my perfect english ๐
severe drift
Talk to gary pls so I can add some phrases
cedar bramble
๐
severe drift
the bot commands channel would have been a better place
because gary can't hear anything in this one
slow imp
N00b @quasi axle
slow imp
m2 o,o
cedar bramble
also the old messages
serene lotus
Feel free to apply to join our closed beta program for our new server. ๐
polar plinth
cough @ivory oyster cough You love breaking shit, you better apply ^
lilac pilot
cough @wary willow cough
wary willow
Y'all fuckers
lilac pilot
lol
serene lotus
๐
wary willow
I applied XD
ivory oyster
lilac pilot
look at glare being all fancy with his fancy email cx
wary willow
I have a fancy email too ๐ข
polar plinth
You kinda do
drifting thistle
@serene lotus ME wants to apply
serene lotus
drifting thistle
ME can code
serene lotus
Me sent you application to join beta
buoyant haven
this fancy enough?
lilac pilot
best email
buoyant haven
it's legit too
gray geode
Can I join? โบ
drifting thistle
FunnyCube me how long waits
buoyant haven
a bit over 9000 hours is my guess
gray geode
Ew
drifting thistle
ME is dead
buoyant haven
ME is gonna make gary delete ur message everytime u say "me"
gray geode
Are you roleplaying or some shit?
serene lotus
lol
gray geode
What are you wearing๐
lilac pilot
hey i mean yall were already waiting 3 years for a server from us, pre sure you can wait a bit longer kek
drifting thistle
ME Is Sketching
gray geode
I didn't know they were waiting g
buoyant haven
ME is currently making the code for gary, I warned u smh
gray geode
Code to apply?
drifting thistle
ME Has Intellij Open
buoyant haven
code to delete his messages everytime he says "me"
drifting thistle
ME has a plugin with 188 DOwnloads ๐ฆ
wary willow
Glare stop
buoyant haven
812 left till dev role
wary willow
Don't destroy
lilac pilot
lol piggy
gray geode
if(message.author.id == 195895802579779584) {
Message.delete();
}
wary willow
messahe
serene lotus
messahe is my fav
wary willow
now we know why guilds bugs out
drifting thistle
ME refreshes the email 24/7
ME Is angry
ME is going to shutdown(SLEEP)
wary willow
if(message.author.id == 195895802579779584) {
Message.delete();
}
Just type with the pizza
buoyant haven
that's a bit better macalite
gray geode
i will beat your ass
buoyant haven
but M should be lowercase, and a space after if is preferred
gray geode
If you keep typing that
serene lotus
Is it pineapple though?
buoyant haven
nothing wrong with pineapple pizza
lilac pilot
better be
drifting thistle
peparonyeeeeeeeeeeeeees
serene lotus
Also we should probs move to #off-topic
gray geode
Caps please sounds like it's asking for more caps
grizzled dew
http://prntscr.com/i68z03
@lapis shadow look at this noob ๐
empty gust
@serene lotus this one guy put his server a billion times in #339676414137860097
.>
Around 8 times
slow imp
maybe he want a review for each sign added ๐คท๐ฝ
serene lotus
indeed 8 times
empty gust
#AhmadForAdmin
thick python
#death
empty gust
idle hare
@slow imp https://hastebin.com/idoridoxod.vbs I just get this everytime :/
slow imp
that sks
idle hare
yeah, destroyed my entire server concept.
empty gust
RIP, when u need the hackers, they never join
empty gust
:/
cedar bramble
Lol
slow imp
yea
empty gust
plz
idle hare
@empty gust you still need a tester?
idle hare
dm me ip.
idle hare
nice bro
empty gust
gg
drifting thistle
whats the ip to test
buoyant haven
@drifting thistle#6933 testplugins.com
slow imp
!ip #bot-commands ๐
empty gust
Life = โข
severe drift
bukkit listeners = ๐
slow imp
Last one have both
polar plinth
EssentialsX also has both
slow imp
Really?
polar plinth
Yep, I added the disposal command myself ๐
drifting thistle
wait
wait wait wait wait wiat weaionidof aef
@polar plinth essentialsX disposal can do both?
as in
one for sign the other for command?
polar plinth
EssentialsX has a sign and command unless they removed my commit in the last week
drifting thistle
oh fuck yes, thank you so much
severe drift
mitch I need help boi
polar plinth
wat
severe drift
empty gust
@woven cloak all of that with no budget? :/
Just do it urself, using DMenus
manually
golden scarab
polar plinth
I know models that are larger..
slow imp
minecraft doesn't render larger models than 3x3x3, afaik
polar plinth
I play on a roleplay server where they have limos and shit
slow imp
ip ?
polar plinth
and non-modden
slow imp
maybe they use more than one morel to create one, if u know what i mean
polar plinth
idk
slow imp
can u click on that texture sign ?
slow imp
The webpage at https://vindexcraft.net/download might be temporarily down or it may have moved permanently to a new web address.
ERR_SSL_UNRECOGNIZED_NAME_ALERT
i don't find any way to download it from there ๐คท๐ฝ
polar plinth
slow imp
74 MB !?
polar plinth
They customize alot of shit
gray geode
What is it
polar plinth
Resource pack for a Roleplay server i play on
gray geode
O
We get back to the castle after a long day of mining i remove my diamond armor and unequip my sword you see my long flowing blonde hair escape my helmet my slightly sweaty body glistens in the torchlight your diamond pickaxe is throbbing continue as steve from minecraft
polar plinth
wa
slow imp
my minecraft crashed :))
gray geode
Sorry wrong number
slow imp
when i've try to use the pack
gray geode
Download more ram
drifting thistle
a
empty gust
a
idle hare
aaa
severe drift
AAAA
slow imp
4 mins ?
empty gust
lol
severe drift
hell yes
idle hare
thats a long trailer.
severe drift
My server trailer is awesome
idle hare
i'd get bored of your server by that time.
slow imp
:))
idle hare
make it like 60 seconds of nonstop action instead.
slow imp
severe drift
the lighting in that is horrible
on the ground but everywhere else is fine
other than that it looks like an epic server
also where is the cinematic camera at ๐ซ
severe drift
k well I recommend replay mod
slow imp
i saw a spigot plugin
severe drift
My name is mr abuse and I like abusing tags
@everyone @everyone @everyone @everyone @everyone @everyone @everyone @everyone @everyone @everyone @everyone
frozen sable
@severe drift I tried watching the trailer, but I couldn't really come further than 2 minutes
@severe drift The everyone tag doesn't really work
severe drift
I already knew that cr
frozen sable
k
severe drift
could you not see the level of mockery in that message
severe drift
make a replica or imitation of something.
frozen sable
ohw
oooo wait, I get it. You're talking about all the people that tag everyone in #339676414137860097 ?
*try to tag
severe drift
indeed
frozen sable
@severe drift Do you need another server trailer? I kinda make them (advertise, advertise) lol
severe drift
Nah I'm ok atm
severe drift
*logan paul crying over japanese forest situation
Get your logan paul crying action figures here
Link in bio
frozen sable
lol
idle hare
I could do with a trailer ๐
frozen sable
Wait, you mean, y-you're asking me to make you a trailer, @idle hare?
frozen sable
lol
frozen sable
My trailers are crap to so that's okay
Just DM me if you really want me to make you a trailer
severe drift
Crjin
frozen sable
je
severe drift
are you good with Photoshop
frozen sable
No.
idle hare
could I have a portfolio :
frozen sable
Yeah, hang on. It's not a large portfolio though
frozen sable
slow imp
do anyone have knowledges about optifine CEM thing?
severe drift
optifine what what
frozen sable
yeah that was my reaction to lol
idle hare
I need to get a better spawn first >.<
frozen sable
lol
frozen sable
Looks nice to me
slow imp
crates reloaded
idle hare
premium?
cedar bramble
Looks great ๐ ๐
slow imp
๐
idle hare
premium ๐ญ
slow imp
it's a free version too
cedar bramble
Only 7.5$ iirc ๐
slow imp
Unlimited Crates
5 Crate Types
2 Effects
Language Support
Economy Support
Chance System
Enchantments
Command and Item Support
Premium
Everything in Free Version
6 Crate Types
40+ Particle Effects
100+ Sound Effects
The Archon and CS:GO Style
Up to Date
Glow Enchantment
Lightning Fast Updates
$10
/cr give player cratename amount
slow imp
doesn't use a flare
slow imp
nope
idle hare
rip
drifting thistle
Hye gaby
eager prairie
how i can delete my all files from one vps?
slow imp
Hey lonely
idle hare
what are ideal staff ranks for a server?
Current ideas: (not in order)
Helper:
Moderator:
Administrator:
Developer:
Builder:
Co-Owner:
Owner:
cedar bramble
Moderator
Co-Owner
idle hare
hmm, alright.
cedar bramble
I think
wary willow
What? Why would you get rid of moderator?
alpine oxide
Helper is kinda useles.
If you have Mods, you don't really need Helper, because they would (in my opinion) do the same job.
idle hare
I tend to class helper as chatmod.
mods are for banning etc, helpers for chat and mutes.
wary willow
Then why get rid of moderator? It sounds better than helper, and helper is used as a way to let people moderate without giving them too much power
cedar bramble
Moderator or helper
wary willow
Like, every other server, even the massive ones, still have mods and helpers
alpine oxide
you should rename them....
Every server has mods, admins and owner....
Give them a unique name.
heavy rapids
Builders should be the lowest @idle hare
Developers under the owners
And a co owner, if you have, well, a co owner
Then managers under the developer, it's up to you if you want the dev or manager higher, but I'd suggest dev
heavy rapids
What if they're half owner ๐
heavy rapids
True
gray geode
Just put Owner for christ sake.
idle hare
I wish there was a way to make it so nobody can join the server until everything is loaded or after a timer.
alpine oxide
@gray geode That would be a good plugin ^
gray geode
Is there not something like this?
heavy rapids
That's ez to make
gray geode
I mean ya, I just shutdown but when I get home I can make something like that
You should check tho to make sure something like this doesn't already exist tho.
heavy rapids
Eh true
idle hare
I've looked, the only one I could find was abandoned in 2014
idle hare
There's an old plugin called autorestart, most people use host control panels to do restarts but I'm home hosting on my server box for the meantime, if anybody could rebuild that plugin for 1.12.2 I'd love them forever.
wary willow
You can get multicraft for homehosted, can't you?
idle hare
Rather not use a control panel :P
I like to have my own softwares and webs for editing.
wary willow
then don't complain that you don't have the same functionality (git gud skrub)
idle hare
:(
I need to invest in a good server host, I'm not paying ยฃ15 monthly for 3 gb when my server box has 16.
And I can run that for free, plus the ยฃ1 yearly fee for the domain >.<
wary willow
Just use Exerforge?
idle hare
Huh
wary willow
Is a host
idle hare
I'll look into it, thank you :P
woven cloak
Can anybody help me
Deluxechat does not have a placeholder for another tags plugin
Wondering if anyone has a solution on how to make one or something
slow imp
If another tags have a placeholder and the plugin support papi should work ๐คท
woven cloak
their placeholder is %tag%
I have no idea how toi use papi
Deluxechat does not have a built in placeholder for TagsGUI
gray geode
Correct
woven cloak
anyway it can?
gray geode
Make an expansion
woven cloak
How do i do that
gray geode
There's a tutorial on the PlaceholderAPI wiki
woven cloak
can you link mne
or wheres the tutorial im on the spigot placeholder expansion page
nvm found it
gray geode
Ahh okay
polar plinth
i might do it for you later if i find the time
cloud matrix
drifting thistle
Tem algum dev Br?
slow imp
cedar bramble
๐
blissful geode
@undone vector ??!
slow imp
actually yes
cedar bramble
Agree ๐
slow imp
u can find on mcm with 15$
but on mcm can be bought by more than 1 ppl
๐
that's why custom servers for only a customer are more expensive
serene tapir
i can pay more...
slow imp
yea but unfortunely u will don't get the premium plugins ๐ฆ
so u should buy them if the person who made it use too much
slow imp
all spigot premium plugins ?!
slow imp
wtf dude ๐
zealous hatch
Well if you can pay more then set a higher price range
serene tapir
i am bad with eclipse :))
zealous hatch
So people would want to sell you a premade server
slow imp
or to made one ๐
empty gust
Everyone has school/work yet servers still exist .-.
serene tapir
EH
idle hare
if you're not gonna put the effort in, why bother.
whos gonna join your server when they're are plenty of others wil people who actually put time into it. and don't buy from somebody else.
slow imp
do anyone know which is the best way to sell pregenerated worlds with a X size?
slow imp
severe drift
I'm trademarking my name so anyone that types it in this server has to use lewis2470โข
otherwise you give me your bank account details
cedar bramble
Lol ๐
slow imp
ok lewis2470
cedar bramble
Gaby ๐ ๐ ๐
slow imp
๐ง
slow imp
lol
cedar bramble
https://api.extendedclip.com/expansions/truefalse/ @gray geode ??
what is that ๐
alpine oxide
@cedar bramble Gives true or false, depending on the placeholder
cedar bramble
need plugin to it?
its not in the wiki so.... if it doesnt need plugin to work shall add it in the first page...
gray geode
Go ahead
cedar bramble
already done that https://www.spigotmc.org/wiki/placeholderapi-placeholders/#truefalse-placeholders ๐
empty gust
So what's True False again? @cedar bramble
cedar bramble
ask glare ๐
empty gust
@gray geode
cedar bramble
as i understand form him (what he said about it) its for dm use it if u want to hide item u can hide it without get ride of it so u can add view requirements
gray geode
It's a work in progress, but yes.
cedar bramble
Glare - Last Sunday at 11:54 AM
view_requirement:
requirements:
anythinghere:
type: string equals ignorecase
input: '%truefalse_true%'
output: yes
Displays the item ^
view_requirement:
requirements:
anythinghere:
type: string equals ignorecase
input: '%truefalse_false%'
output: yes
Hides it ^
Should be just like that
If it works right ๐
gray geode
I think I need to fix one little thing, but yes.
alpine oxide
Still don't get how they work
gray geode
If the string equals output, they see they item because of the view requirement
idle hare
little idea for somebody, can somebody make a plugin that stops a player taming wolves.
gray geode
If you got like $5, I'll make it right now lol
idle hare
because i'm getting a weird glitch whenever a wolf dies on my server :/
hmm.
i'm broke man.
gray geode
:/
idle hare
I do really need it though.. so I might be able to find some cash.
gray geode
๐
idle hare
unless you know the problem obviously, I shall share my issue.
https://imgur.com/a/Ut6p4
Everytime I kill a tamed wolf, it shows a death message >.<
idle hare
I was planning to get askyblock, that has a death message silence but not sure if it works for this instance.
gray geode
I thought it was a simple bukkit.yml config setting for death messages.I guess not.
alpine oxide
It should be...
Or at least there should be a gamerule that can be switched off by either the vanilla-gamrule command or the Multiverse gamerule command (if you use Multiverse)
idle hare
hmm, i'll look into it.
I don't understand why wolfs are getting death messages tho
oo that did it!
gray geode
Lol
idle hare
what are the benefits of using mysql btw?
idle hare
Thing is I'm hosting from one box, all my files are stored there and not through some server panel.
Also, love it wen windows 10 randomly blue screens you.
gray geode
Lol
shy robin
mysql is faster, better and less problems with corruption
idle hare
Coming across a decent builder these days is so tricky.
severe drift
Did u see the build shown on minecraft Twitter today!???
idle hare
No?
severe drift
Well it was insane
idle hare
I just need somebody that understands the fundamentals of building a spawn >.>
severe drift
Surely you knew already that barely anyone does unpaid offers
solemn lintel
i need help finding my plugin that i use for custom commands
like my /vote command
main ermine
You can use mycmd
serene lotus
Anyone who applied for SkyRuins beta, I suggest reading your emails
polar plinth
^
serene lotus
for skyruins staff
serene lotus
nope
modest copper
damn
wary willow
Make me a Helper ๐
modest copper
damn
severe drift
Thank you admins for accepting my app!
serene lotus
everyone for skyruins got accepted lol
serene lotus
New server i made with some friends
low wasp
ahh nice
serene lotus
slow imp
it's cool when u have java knowledges to made a server ๐๐ฝ
low wasp
Is that to become staff or join the server?
sinful ravine
Lewis you got staff on skyruins?
sinful ravine
Oh ok
low wasp
What kind of server is it?
slow imp
a cool one ๐
low wasp
Like skyblock, skywars or something? i assume its one of them due to the name
serene lotus
skyblock
low wasp
ahh okay
Applied
Also how do people recommend going about advertising a server? Good, but cheap ways ๐
serene lotus
@wet oasis ^
low wasp
Scrooge level
Iโm Co-Owner of a server and the other owner deals with the funds. Know a fair bit about advertising just wanted some other opinions
Iโve just seen lots of advertising techniques bring players to servers, but none stay and donate. Just wondering what techniques work for others
wet oasis
Well, advertising will only bring players. The quality and content of the server is what will make them consider donating
wet oasis
Well, for YouTubers, if your budget is tight, going for multiple small creators over 1 large one would be better
low wasp
More vids from smaller ones rather than 1 from a larger ones. Yea. Players follow their youtuber so having a few youtubers do series is better (the stay players stay)
My sever isnโt near the Advertising phase, Iโm just thinking ahead for different methods
wet oasis
I see.
Other options are:
Reddit: MCServers sub reddit
Minecraft forums: forum post
PlanetMinecraft: Server list and post in their chat box (follow their rules)
Don't go crazy on the vote sites, the smaller ones aren't beneficial, stick to 3-5, I tend to go for:
proud turtle
so what's the server ip for testplugins.com?
proud turtle
yes : D
shy robin
you legit said the IP
proud turtle
ok
topaz linden
said ip in channel other than rate. ban
proud turtle
@nmrat#6878 they will ban you
slow imp
Me 2
idle hare
I got an og name, fear me.
slow imp
What OG means ?
nimble spear
What is your opinion on this name? TenseMC
wary willow
Doesn't really make sense, like what kind of logo would "tense" be, unless it's some kind of horror server
weary pewter
buoyant haven
rafric, this isn't a place to advertise your server, nor is it likely anyone in here would actually play on it
buoyant haven
This server is mostly filled with server owners and developers, they have their own servers to look after and play, they're usually not looking for a different one
shy robin
^^
shy robin
you can get feedback in #339676414137860097 though
shy robin
np!
timid bear
Anyone that have the FeatherBoard plugin for me? @here
shy robin
are you dumb?
alpine oxide
@timid bear Buy it yourself
shy robin
first of all, nobody here supports the leaking of plugins.
second clip is a sort of friend of the creator of featherboard.
third @ here does not work for you.
polar plinth
cough @noble robin cough
timid bear
pff...
Why sold i buy him? But more people have the plugin.
They can give it to me.
shy robin
this kid
how fucking stupid can you be lmfao
the nice thing is that we see that people who speak dutch/vlaams make great plugins
@noble robin am i right?
noble robin
Always
shy robin
๐
main ermine
For example i don't speak Dutch and i don't make great plugins ๐ ๐ ๐
alpine oxide
same.
slow imp
๐
severe drift
I don't know what you're all talking about so I'm going to be the annoying guy who changes the subject
Anyone going to make the plugin that replaces creeper explosions with cake items?
shy robin
@ancient abyssis2470#6049 do you mean a cake which drops as an item or a cake being placed at the explosion?
and the explosion being cancelled or not?
wary willow
(Wrong Lewis)
ancient abyss
xD
drifting thistle
Staff?
idle hare
Does hydra actually do what it says?
idle hare
I'd have to pay for that.
wary willow
If it doesn't, ask the dev for a refund
idle hare
The reviews say it's good, so I guess I'll go with them.
idle hare
Why not use that one?
drifting thistle
@idle hare has bugs in it
severe drift
Hello DanTDM_clone #127137229
cedar bramble
Looks not bad...
slow imp
not too bad
trim hill
:p
ionic pulsar
@trim hill I'd suggest lining the base of the i up with the rest of the letters, and having the dot be slightly above.
But other than that, I like the colors and the font ๐
trim hill
Thanks @ionic pulsar ๐
ionic pulsar
No problem! ๐
trim hill
i perfer spawns on this level ya know ๐ https://i.ytimg.com/vi/PtCbm9z2XH4/hqdefault.jpg
ionic pulsar
Looking AWESOME! @idle hare
idle hare
@PaulHotel#6911 this guy has advertised his server multiple times and even tried to use the everyone tag.
severe drift
he is a scum
austere jacinth
@lapis shadow or @lilac pilot Mind if i get some assistance
severe drift
...
empty gust
Gg bois
buoyant haven
@DรธctรธrDiscรธ | ใใฃในใณ#9437 Don't tag lillabele, just ask in #general-plugins without tagging anyone
gusty sleet
https://i.imgur.com/smsCcvA.png
anyone know what character they're using for this?
jagged pulsar
tall thicket
.
cedar bramble
@rose sky u aren't able to advertise in this server
Can u place delete the message?
Also spamming isnt allowed
Delete the message in the other channels or u will get ban ๐
Its still there
alpine oxide
@rose sky Your adverisement is still visible
Remove them from any channel you posted or you'll recieve a punishment
cedar bramble
And if its "help" u shouldn't sent in an almost all the server's channels ๐
severe drift
more desperate people keep appearing every day
donate $1 every month to help make the desperate people be non desperate
hazy tiger
polar plinth
My tags explain alot
severe drift
What
wary willow
"skyruins"
empty gust
ew
severe drift
wow I've only just noticed the crown icon on funny
empty gust
Yeh, they added it like a week back on Canary
severe drift
Must be because I only just bothered to click the update button
empty gust
Understandable
idle hare
can anybody reccomend me a good hosting company fairly close to London, I need good quality but i'd prefer to not go with a mainstream such as pro-hosting etc
alpine oxide
I use Warenode.com
I'm not completely sure, where the serverlocations are....
They where in London, but as far as I can remember did they switch to germany....
idle hare
holy crap thats cheap.
alpine oxide
But the quality is quite good
idle hare
i'll look into it.
I was looking at pebblehost
so do they have a control panel or anything?
alpine oxide
controlpanel like?
idle hare
do they have an interface for file management or do you just remotely connect?
alpine oxide
Depends on what you're choosing.
They have MC-Serverplans that come with Pterodactyl
idle hare
yeah, was gonna go with an mc one, alright i'll do some research into their panel.
alpine oxide
They have a Discord for support.
I could send you a invite in PM, if you want
idle hare
please do
undone estuary
hey ya
alpine oxide
\[T]
severe drift
mother of god
nimble spear
What do you recommend? (.net) or (.com) or (.org) or others?
errant spear
I presonally like .com
But if a domain is already registered with .com don't let that stop you from claiming .net
untold magnet
What about a us domain? They are ussually cheaper
polar plinth
.us domain = self dox
wary willow
^
untold magnet
I'm sorry, I'm not familiar with that term. Could you explain?
buoyant haven
@untold magnet basically giving all your person information out, including phone number, home address, full name, and sometimes your relatives details aswell
slow imp
๐
buoyant haven
untold magnet
Oh well, thanks for the information ๐
polar plinth
You can't get WhoIs protection on .us domains, same rule applies to .com.au, .uk .eu, .de etc. afaik, generally most country specific domains, WhoIs protection is the thing that hides your personal information from pages like https://www.namecheap.com/domains/whois.aspx where you can find out information about the domains.
Hence, they reveal personal information, hence, self-dox. @ToastedCoconut#7957
unique zodiac
Um someones posted a supposed DeluxeChat free version on spigot lol theyve literally copied everything from the originasl post
slow imp
link?
unique zodiac
The guy who posted it look at his other resource xD someone elses plugin. Anyway just thought id tell ya in case
severe drift
My brain has 0912841203498120923148120 Petabytes of free memory
as you can see I have used a lot of space
drifting thistle
not even funny
alpine oxide
plugin was removed (or never existed? ๐ค )
slow imp
Was reported
slow imp
buttons too
wanton palm
Sorta off topic but would a decent AMD processor, like 16 gigs of ram and a 250GB ssd be a decent server block to host things such as MC and stuff??
reason I said AMD is because more cores, intel i feel is for gaming
slow imp
i use a CPU: Intel Xeon E3-1245v5 - 4c/8t - 3.5GHz /3.9GHz and it's good enough
i run 5 servers atm
buoyant haven
hi
severe drift
Is Intel i7 good with GTX 1080 ti
buoyant haven
which i7?
severe drift
7700k
slow imp
nice
severe drift
I have it
buoyant haven
o
buoyant haven
I got a piddly gtx 960 paired with my 7700k
waiting for volta consumer cards before upgrading
severe drift
I still have an AMD cpu <-- yuk
buoyant haven
which one?
severe drift
I don't even know it came with the desktop PC I got
buoyant haven
o
severe drift
But it sucks
jovial heart
Anyone know any good ways to advertise a minecraft server? I know the obvious ones like server-lists.
rocky cape
^^
severe drift
Ask players that join to share to their friends
other social medias like twitter, facebook etc.
rocky cape
Advertising the hardest part, you could have the best server ever, and still people wouldnโt play unless there were many on
severe drift
You could try to start things unique that keeps players on, e.g. some kind of build contest events or something else
undone estuary
heyall can someone help me out testing for 1 sec on my server ?
wraith fog
@nimble spear plugin name https://prnt.sc/iczqiw
spiral pelican
Heyy
nimble spear
@wraith fog Straconyโs magical works.jar
twilit aurora
@Stracony#0308 2nd
wraith fog
@nimble spear 2
sharp spindle
How do I change the version of my server? (1.8 -> 1.12)
cedar bramble
Remove ur current jar and replace it with 1.12 jar ๐ ๐
severe drift
building jars for spigot is painful
gray geode
You mean BuildTools?
undone estuary
i like jazz
empty gust
slow imp
Does this look ok: https://gyazo.com/80fa69214359f9c94a6ceb09675c541f ?
severe drift
If you turned off advanced tooltips then yes
olive dome
๐
severe drift
that's better boi
slow imp
i saw ๐
fierce light
Anyone know of a great list of all minecraft items and blocks picutres kinda how they display ingame?
alpine oxide
uhm... what?
fierce light
I am looking for icons for all blocks for a website thing that I am building
nimble spear
Urgent!!
What is better?
http://prntscr.com/iew56s
http://prntscr.com/iew5c1
or..
http://prntscr.com/iew5fy
http://prntscr.com/iew5m6
sacred vector
1st one.
cedar bramble
@fierce light http://minecraft-ids.grahamedgecombe.com maybe ?
empty gust
fierce light
@cedar bramble I could use that. I just wasn't sure if I wanted to steal them from a website
slow imp
These are some mc items , lul
unique zodiac
Cant u just use the assets folder in the base game?
slow imp
๐ 
idle hare
When a huge server forgets to disable /ver >.<
wary willow
kek
severe drift
loool
nimble spear
I need an opinion here.
-
When a player first logs into my server should they automatically be directed to a tutorial, but still be able to quit
-
Or should they automatically be given the HUD items to begin their journey
idle hare
hud items
slow imp
@lapis shadow i'm allowed to use your plugins pictures, for mcm resources? โค
empty gust
cube's plooooogin pictoores?!
slow imp
:))
@serene lotus this one fe https://www.spigotmc.org/data/resource_icons/4/4390.jpg?1424962280
serene lotus
oof, i made that
slow imp
ik ๐
serene lotus
pls no steal
half dew
?
sharp spindle
wrong person mb :p
half dew
wrong tag xD
sharp spindle
just typed gab and pressed enter
slow imp
check #367904196441276419 ๐
sharp spindle
what's clips discord name?
empty gust
clip#9097 @sharp spindle
lapis shadow
Anyone want to play minecraft with me
slow imp
Anyone want dchat v2.0 ?
severe drift
anyone want the new update for deluxemenus yet
slow imp
oooooooo nice one ๐คฃ
i really need that update
but channels on dchat are needed too
gusty sleet
Lots of cool stuff coming from Clip lately!
untold magnet
Anyone has a good idea for server names?
cerulean mauve
i'm back in business.. first I need to gain the access to my spigot account...
i'm sure some of my premium resources are flagged as inactive ๐ญ
slow imp
๐
drifting thistle
I need help!
slow imp
we can't read minds ๐
alpine oxide
It also depends on what placeholders you want to use.....
FeatherBoard has its own placeholders
drifting thistle
Okey?
alpine oxide
You should check this page: https://www.spigotmc.org/wiki/mvdw-placeholders/
drifting thistle
But, What should I use if I have MassiveCore Factions?
slow imp
massive core placeholders ๐คฆ๐ฝ
nimble spear
Ahhh OCD. Correct the spelling errors please and take the issue over to #general-plugins
hallow zealot
How long does it take for a donation to spigotmc to appear on the forums/your profile?
hallow zealot
Nevermind, made a post in donations forum
idle hare
Is it just me that's never gonna trust minecraftmarket
alpine oxide
McM is shit imo
idle hare
Yeah; it's the only place I've seen to find reasonable devs however.
With the exception of here.
alpine oxide
I currently make a own page for resources with a friend....
We already have the dev from SkinRestorer there ๐
idle hare
Never heard of skinrestorer lol
alpine oxide
It's a good plugin for Offline-servers, where people want to keep their skin....
idle hare
Are these devs for hire though. That's what I'm after.
alpine oxide
idk
idle hare
I can't find anywhere that offers decent development that I can trust.
Blows my mind how big servers find their devs.
heavy rapids
I'm for hire ๐ @idle hare
slow imp
Big servers = a lot
heavy rapids
^^^
heavy rapids
lol
idle hare
Yeah but like how do they find them. And I know you're for hire dark ๐
cerulean mauve
many devs submit their expression of interests and they can just pick the best ones.
if they found someone on the community, sometimes they directly approach devs.
heavy rapids
Most devs go to the big servers, the big servers don't go to them
severe drift
I use notascamdefinitelyrealpleaseclick.com to get free money
heavy rapids
xD
severe drift
Opinions on the new channeling enchantment anyone?
slow imp
What's that?
severe drift
It's for the new trident item in the snapshots
slow imp
What it does?
severe drift
Summons lightning on a mob of the trident hits it during a thunderstorm
severe drift
Hm
slow imp
Mc 1.13 is cool as fk
slow imp
Ikk
idle hare
ban trident :o
idle hare
swimming animations!?
slow imp
aha
idle hare
I see human fish tanks becoming a reality
slow imp
1.13 โค
1.13 is cool as fak
haved you see what can we do with an axe and any type of log?!
alpine oxide
uhm.... if you test the snapshot and watch snapshot-videos?
slow imp
?
alpine oxide
Your question.... It's so.....
slow imp
:c
idle hare
@pearl rover nobody will develop a skript for you. if you can't even understand that you shouldn't be running a server to be honest. it's simple english.
void lodge
@idle hare Woah, Hey calm down ๐
idle hare
:(
severe drift
I'm not a fan of stripped logs
It would probably get annoying seeing how easy it is to right click with an axe
slow imp
:))
idle hare
https://www.spigotmc.org/resources/sk-sleepers.53535/ somebody used my plugin idea.. except they made a skript.
Or it's just coincidence.
fallen rune
if theres several thousand players it will lag on player join or leave
nah
You can make efficient shit in skript
you just have to know how
and not be spaz
same with java but
idle hare
Or just learn java, and actually be able to apply it in the working world ;)
fallen rune
Skript isnt that bad depending on the dev, I mean its bad eiother way but depending ont he dev will depend if it lags
I started in skript
It helps you learn other languages
like python, cause the same ideas go across
although the way skript stores and handle data
๐คข
I am learning java
idle hare
Never really looked into it. Just know half the crap that comes from it is rip offs.
fallen rune
But for stuff I cant do in java I do in skript until I can do it in java
idle hare
I see people make 'mineplex core' in skript,
fallen rune
Oh yeah 95% of skript developers don't know what they are doing
the MP-Core is actually made very well (the one I'm talking about)
but at that scale they should have just done java
idle hare
I don't doubt it is. But just play mineplex.