off-topic

[lament ember]

send
us
the
files

[fallow crow]

but keep in mind they dont own cheatbreaker

I sent ivan them

[sullen sorrel]

l m a o

[lament ember]

send them to us too

[light scaffold]

I own cheatbreaker

[fallow crow]

yes but Ivan's are broken or something

send them to me directly

[sullen sorrel]

this is too funny

[lament ember]

DM them to us

[analog marlin]

vision if you don't want to send them to anyone else then you accept that I got the correct files the first time

[lament ember]

actually DM them to Fefo and then Fefo can send them to me

[fallow crow]

If I'm making a garbage collector using SQL can it connect to PHP naturally without XAMPP?

[light scaffold]

Hahahahahahahahahahahahahahahahahahabahahagahagahahahahhahahahahahahaha

[sullen sorrel]

changing the topic

[lament ember]

you can't make a GC in SQL

[long summit]

You sure Google doesn't own it?

[analog marlin]

don't try to change the subject with your gibberish now

[light scaffold]

Hahahahahahahahahahahahahahahahahahahabahabahahahahahahahagahahahagahahahahhahahahahagagagahagagaha

[lament ember]

you cannot make a GC in SQL

[fallow crow]

No, Amazon doesn't own SQL

[lament ember]

it is impossible

[light scaffold]

Hdhwjajajahagahshrhsjajahrhthdjdehahahshrhsbshahfbdjwnanshfhsjababf

Kskfjekwkskdkekekamansbhfidhsbajskfnenqnaka

[fallow crow]

I'm saying display GC data through the SQL

not make the SQL itself a GC

[sharp sky]

@light scaffold did you just take drugs? 👀

[light scaffold]

Fjfjrjwjwjanfjtjrjeienrbrjrjrnwnwjejfkgmvnxbqbwhrgtjwoqngjfje wjakgjtnrnwnqkvjvjsjnnwebejqkanfbr

[fallow crow]

^

[lament ember]

yeah that's gonna make it even slower HAHAHAHAHAHAHAHA

[sullen sorrel]

it worked

[analog marlin]

it did

[long summit]

Ah i see

[mellow zinc]

If I'm making a garbage collector using SQL

[analog marlin]

you could theoretically log everything that happens in a gc in an sql server

[lament ember]

if you're making DB queries to put data into an SQL DB

[analog marlin]

but why?

[light scaffold]

Kfkekekekekekemrmrjrjememekekskakskvnfhdhwhqgwhwhshenwbqbqbabebrbebwbwbqnqnabcnvjcjsjqnebtbenwnwbqhfhchejwbtjtjwnqnajdiguviflekwnqnfbtbebwhwhahdhrhtgtvebwhqhshthtjrbehwbqnqjrjvijtjrowowlqkajfhghrhebwbqbqbabcnvnfjrbebw

HE SAID IT

[lament ember]

you have 0 brains I swear

gonna bring back an old classic GIF for this

[fallow crow]

@fallow crow DM me the client files please, my DMs are open

yeah I mean if something is CPU intensive I want to know that it is

[analog marlin]

anyways @fallow crow since the client didn't work

[fallow crow]

not sure why thats bad

[analog marlin]

can i have the bitcoin address?

[lament ember]

https://tenor.com/65Ux.gif

[mellow zinc]

LOL

sx 🥲

[analog marlin]

since i can't join the server myself

would you be so kind as to send it in the chat

[mellow zinc]

can i have the bitcoin address?

[fallow crow]

the fastest GCDC to ever exist

[light scaffold]

Can I have the $50k you owe me

[fallow crow]

anyways I need to head off because its a little late

@fallow crow DM me the client files please, my DMs are open

[mellow zinc]

can i have the bitcoin address?

[analog marlin]

send the bitcoin address

or even a screenshot of you on your server

[sullen sorrel]

wait - delete #827055634586271775 message

[analog marlin]

with the 50 players

[lament ember]

avoiding question after question won't get you anywhere

[analog marlin]

i'll take that tbh

[sullen sorrel]

you realize how easy that is to fake

[fallow crow]

why would I delete that

@fallow crow DM me the client files please, my DMs are open

GCDC is a good software

[lament ember]

you are stupid

[sullen sorrel]

lol

[lament ember]

that's the only fact here

[analog marlin]

yes but i also don't have much confidence that he'll do it correctly

[velvet crescent]

bruh still going at it

[sullen sorrel]

true

[velvet crescent]

I've half made a fucking cake in the mean time

[lament ember]

the entire idea of taking GC results and making a DB query is just idiotic

[light scaffold]

My PayPal is open, send me 50k

[fallow crow]

@fallow crow DM me the client files please, my DMs are open

[sullen sorrel]

hes exposed himself anyways, idk why hes still not admitting it

[analog marlin]

frosty he sent the client to connect to his server

[fallow crow]

Anyways Im gonna go to sleep cause its kind of late

[analog marlin]

in 5 parts

[mellow zinc]

frosty why u being productive for

[fallow crow]

NO

THE FILES

[analog marlin]

they were each the protocollib jar

[fallow crow]

PLEASE

[mellow zinc]

just sit on discord for hours talking about an sql gc instead 🤡

[fallow crow]

I WANT to JOIN YOUR server

[lament ember]

he won't give you the files because he's talking out of his ass lol

[velvet crescent]

Kali, moms birthday tommorrow

gotta be

[lament ember]

he's going off because he doesn't know what to do

[mellow zinc]

o pog

[sharp sky]

@velvet crescent if only you could rejoin staff 🤡

[lament ember]

or he is really this stupid

[fading grove]

you guys are still talking about this bullshit even after I had band and world cultures class?

[fallow crow]

now I wonder who out of you two is more stupid...

[lament ember]

one of the two

[mellow zinc]

tell her i said happy birthday 🥲

[lament ember]

yeah ik I'm stating the obvious

[velvet crescent]

Yeah nah I'm good, but still thanks I guess? kek

[fallow crow]

also how many GCs can I operate at once if Im using ZGC as my main one without Paper, I'm using a custom jar

[analog marlin]

vision send me your server bitcoin address and i'll send it $20

[fallow crow]

and G1GC

[sullen sorrel]

changing the topic, I see

[fallow crow]

all of them

[lament ember]

custom JAR

[light scaffold]

At least 3

[lament ember]

not one of those

oh no

[fallow crow]

I have actually pulled off all of the GCs (even a custom one) running on a Yatopia server

[lament ember]

not one of those who uses some custom proprietary MCM fork or some shit

[fallow crow]

for maximum performance

at the same time

I also want to display all my GCs through my panel if possible

[lament ember]

profilers exist

and JMX

and metrics

and the list goes on

[fading grove]

guys hes a troll

just stop lmao

[mellow zinc]

no pulse

[fallow crow]

I am not a troll

[lament ember]

nah no shit sherlock

[mellow zinc]

its free xp

[sullen sorrel]

yea right

lmao

[analog marlin]

vision you sent me the same jar, renamed, 5 times and claimed it was a client

[fading grove]

oh shit

you're right

let me get into this conversation

[lament ember]

either you're a troll or you're one of the biggest idiots I've seen in a long while

[fallow crow]

DM the the files please I want to join your server

[light scaffold]

Alright man so you've got your PHPMyAdmin setup to hook into JNI right?

[fading grove]

Aiyo give me that xp

[fallow crow]

if I was a troll I would have agreed with you that "GoOOGLE OWNS CHEATBrEAKER"

[fading grove]

yo please give me

[fading grove]

lmao

[fallow crow]

why would google own a client

[fading grove]

Add haskell bindings to that JNI

[sullen sorrel]

❓

[analog marlin]

who said that lmao

[fading grove]

then your set

[fallow crow]

they have 0 connection to minecrat

goodnight

[fallow crow]

No one said that

case closed

you are the only one claiming that

no

DM me the files

[fading grove]

please have a nightmare

[fallow crow]

I want to join your server

please

[fading grove]

please give us the files daddy

give us files daddy

[fallow crow]

and give you moneys

[analog marlin]

dm fefo the files please

[fallow crow]

from simps

[fading grove]

please mommy!

[fallow crow]

simp money

[sullen sorrel]

thanks for being a troll, you brought some good laughs

[fading grove]

daddy gives me!

[mellow zinc]

please find the message link to whoever said cheatbreaker is owned by google

because the only message link ull find is from urself 💀

[fading grove]

i hope you die in a hole

xd

@fallow crow

@fallow crow

[mellow zinc]

ok not nice pulse

[light scaffold]

yeeeEEEEEsss 😖 😖 😩 😩 😌

[fallow crow]

Vision PLEASE I want to join your server

[fading grove]

Hey its for the Xp

[mellow zinc]

no

[fading grove]

Yesssssssss

[fallow crow]

a little mean but alright, thank you

[light scaffold]

Vis

[fading grove]

https://github.com/neurocyte/foreign-jni

https://github.com/neurocyte/foreign-jni

[analog marlin]

vis, you still owe BM $25k

he put a lot of work into that encryption algorithm

[mellow zinc]

edate visiion

[fading grove]

edate vision

lol

[lament ember]

also, you being called vision is pretty ironic, because you miss 99% of the facts that we keep telling you

[mellow zinc]

the perfect candidate - hes rich

[light scaffold]

I am available for hire, $200/hr, I know about 40 languages and can do pretty much anything you like

[fading grove]

he aint got vision. he just blind

[fallow crow]

I lost a bet I cant pay 25k to anyone rn unless its for the GC

[light scaffold]

I'll make the GC

[velvet crescent]

Damn, you're cheap

[light scaffold]

Bet

[analog marlin]

you're getting 60k a month

[light scaffold]

Forgot a 0 sorry

[analog marlin]

and you're running a server for 50 people

[fallow crow]

i dont get 60k a month

when did i say that

[light scaffold]

Fixed it

[lament ember]

I'm $0/hr

[fallow crow]

anyways im going to sleep goodnight

[lament ember]

just gotta get me interested

[fallow crow]

google does not own cheatbreaker

[mellow zinc]

dont

[fallow crow]

case closed

[mellow zinc]

send the bitcoin address

[velvet crescent]

I was offered 20 for my doodoo code

[fallow crow]

.???????

[light scaffold]

Do you know how to make a SQL GC though

[lament ember]

lol just go to bed now

[light scaffold]

I don't think so

[fallow crow]

you've said that like 7 times

[lament ember]

I do know that it's a stupid idea

[fallow crow]

and that

[sullen sorrel]

if this was irl vision would be running out

[light scaffold]

I can do it

[velvet crescent]

if I finish making this cake before y'all done, this is gonna be sad

[fading grove]

I literally had 2 classes

[analog marlin]

oh you know what my bad

[fading grove]

lol

[analog marlin]

you said 4-5k a month

[sullen sorrel]

he went to "sleep"

[mellow zinc]

in before Vision is typing...

[analog marlin]

i'm sure BM is willing to get paid in installments so it's no worries

[fading grove]

we must force him to haskell!

he must be tortured by Haskell!

Haskell will bring him to his knees

[light scaffold]

torture?

Quite the opposite

[fading grove]

No like

he will need to be forced

to learn it

you know

[sullen sorrel]

haskell 😍 🥰

[fading grove]

haskell is good you know

yeah

[light scaffold]

So true

Look how many clever people there are in this server

[lament ember]

https://imgflip.com/i/576m9f

[mellow zinc]

#dev-general message this u?

[analog marlin]

#dev-general message

lmao

[mellow zinc]

nice 👍

[sullen sorrel]

idk

[light scaffold]

Even trump agrees!!

[sullen sorrel]

kotlin is still best language

[sharp sky]

@wary willow the hell is this 👀

[sullen sorrel]

haskell bad compared to kotlin

[sharp sky]

#bot-commands message

[light scaffold]

Untrue

[lament ember]

Trump wouldn't even know what an EXE file is, let alone how to program in Haskell

[wary willow]

what?

[light scaffold]

trump knows more about haskell than you ever will

[wary willow]

what;'s wrong with that?

[light scaffold]

Trump knows what a monad is

[sharp sky]

I linked the msg

[sullen sorrel]

bm

can you teach me haskell

i am changing my ways

[wary willow]

yeah but what's wrong with that?

[light scaffold]

yes

[analog marlin]

anyways i actually got a great idea from this whole debacle
if i ever decide to take on vision's role somewhere
i'm going to generate a file with a custom sha-1 / md5 hash that includes RICKROLL in the hash
and send that to people

[sharp sky]

You high that time?

[light scaffold]

free haskell lessons to anyone

[wary willow]

I did it in #bot-commands for a reason... to not spam it lmao. Was just bored

[sullen sorrel]

bm do you use light mode

[sharp sky]

🤔

[light scaffold]

No

[sullen sorrel]

sucks

oh

1 thing

[fallow crow]

someone ban this kid

[normal sable]

perfect 🤩

[sullen sorrel]

why do roles look so ugly in light mode

[sharp sky]

Just spam it here @wary willow 👀

[light scaffold]

@normal sable

[normal sable]

they look normal wdym

[sullen sorrel]

it looks faded

[wary willow]

bcz you use light mode ...

[sullen sorrel]

but

u guys overreact

[wary willow]

sure. just gonna make a text wall of OoOs

[sullen sorrel]

its not that bad overall

[analog marlin]

by the way did vision ever delete his request

i can't see so idk

[sullen sorrel]

no

[normal sable]

why r u muted

[analog marlin]

i copied and pasted vision's request and changed it a lil bit

and posted that

[normal sable]

LOL

[sullen sorrel]

[Service] Haskell developer, C with classes Developer, Database engineer, DogeCoin angel investor
[Request] The positions above are needed to create a team for my hybrid relational database garbage collector & anti-garbage collector virus software. DMs* are not available due to me having 1+ dms I haven't opened and need to read, please reach out to me in a channel in this discord guild.
[Budget] $57,015
@analog marlin

[analog marlin]

then got insta banned for it

[light scaffold]

Haskell developer????????????

[analog marlin]

yea that's mine lol

[light scaffold]

OMG!

Sign me up baby!!!!!

[sharp sky]

Welcome to your worst nightmare

[analog marlin]

anyways i think it's only fair that vision's is also taken down

[sullen sorrel]

proof

[normal sable]

u gonna unblur your servers or what

[boreal escarp]

https://www.facebook.com/groups/2432095937041581/permalink/2789890507928787/?sfnsn=mo

[sharp sky]

https://youtu.be/qWwb8S02f_c

[normal sable]

nice

[sharp sky]

Phew

[analog marlin]

🤡

[sullen sorrel]

🤡

[sharp sky]

Not that clown 👀

[analog marlin]

=remindme help

[honest thistle]

Reminders | Invalid Tier

You need to be at least Tier V in order to set reminders!

Requested by: Ivan8or#7412

[analog marlin]

aw

[sullen sorrel]

=remindme help

[honest thistle]

Reminders | Invalid Args

Missing Quotes
Usage: =remindme <time> "<message>"
eg. =remindme in 5 hours "to feed the Llama"

Requested by: dkim19375#6351

[sullen sorrel]

smh

[analog marlin]

i cri

[sharp sky]

||gud||

[sullen sorrel]

||git gud||

[sharp sky]

Dkim be like pretending to know craps by replicating everything from the beginning of the conversation up until now 🤡

[sullen sorrel]

👀

[lament ember]

@analog marlin imagine not being tier 5 smh my head

[sullen sorrel]

@analog marlin imagine not being tier 5 smh my head

[sharp sky]

See?

[analog marlin]

i can't help it, i can't be bothered doing the =daily

[sharp sky]

The weirdest specimen

[sullen sorrel]

😳

dont expose me

[sharp sky]

All dkim patterns:

Lol

Hmm

👀

[velvet crescent]

Imagine not being tier 7 smh my head

[sharp sky]

😳

[light scaffold]

Tier 8 btw

[lament ember]

BM that's your queue

[sharp sky]

¯\_(ツ)_/¯

[sullen sorrel]

would you recognize me if i went on an alt

[light scaffold]

Too late

[velvet crescent]

Yea cause goddamn nitro booster

[sharp sky]

Yes...

[velvet crescent]

overpowered.

[sullen sorrel]

hm

don't be surprised if you see a new member suddenly active and me being inactive sometime soon

[sharp sky]

There's the pattern

[sullen sorrel]

aAAAA

[sharp sky]

Try me

[sullen sorrel]

b-but

[sharp sky]

I am good at identifying replication

[sullen sorrel]

hm

but it'll be too obvious

if i go offline and a new member becomes active

[mellow zinc]

what are u trying to say

[sullen sorrel]

lol the last time my alt talked on here was on 4/16/2021

wait

thats so close

i dont remember talking on my alt

lol

[sharp sky]

Stop with the nonsense and get it over with 👀

[sullen sorrel]

nooo 😩

i can't reveal any other information about my alt

[sharp sky]

Or say

[sullen sorrel]

or else you can easily use discord's search feature

[sharp sky]

"I am forever a coward"

:)

[sullen sorrel]

nooOooooOoOo

[sharp sky]

I don't even know which alt is you lol

[sullen sorrel]

thats good

[mellow zinc]

7k messages on 16th april

im good ty

[sullen sorrel]

i have about 150 messages on my alt

in this server

[sharp sky]

That is... if you hadn't sent this obvious clue......

[sullen sorrel]

i already regret sending that message

lol

[sharp sky]

Coward 👀

[sullen sorrel]

ok now my last message is before 2021

🙂

oh wait

[analog marlin]

i wonder what the curve looks like for messages sent by all members

[sullen sorrel]

something called logs

[mellow zinc]

staff

[sullen sorrel]

f

dont look in logs

[mellow zinc]

@long summit who deleted the last message in this server

[sullen sorrel]

hows ur day everyone

STOP

NO

PLS

NOOO

😩

😫

STOPPpp

[sharp sky]

I don't have logs about that info nor knowing who it is

[sullen sorrel]

MY IDENTITY

what

[mellow zinc]

mhm

[sullen sorrel]

staff do

[sharp sky]

Welp

[mellow zinc]

sure

[sharp sky]

Time to bribe them

[sullen sorrel]

phew matt is offline

gives me some time

NO

[mellow zinc]

is he?

[sullen sorrel]

MATT WHY

[long summit]

Now it was efe, but before it was Cutest

[sharp sky]

@wary willow check logs of his ^ :)

[long summit]

I am always here

[sullen sorrel]

please

[mellow zinc]

that is very interesting

[sharp sky]

Ooh

[sullen sorrel]

please

i'll have to make a new alt

1 sec

oh i have to make a new email account too

[mellow zinc]

why tho?

why do u need an alt

[light scaffold]

dkim using C?

[sullen sorrel]

so that i wont get bullied 🙂

[light scaffold]

nah

[sharp sky]

Yes sure

[light scaffold]

it cant be

[sullen sorrel]

no

i dont use c

[light scaffold]

dkim would know that putting a request for C help in #827055635052888075 is a bad idea

[sharp sky]

🤡

[sullen sorrel]

🤡

[analog marlin]

what happened lol

[sullen sorrel]

okay maybe im free

maybe my alt hasn't been revealed

😌

terrifying

[light scaffold]

this is apparently dkim's alt

im not convinced

[sullen sorrel]

no

its not my alt

[mellow zinc]

neither

[sharp sky]

Is your alt joined? 👀

[sullen sorrel]

yes

it is tier 1

[sharp sky]

Matt check who has just joined recently

[mellow zinc]

matt who were the last 5 people to delete a message

[sullen sorrel]

no i didn't join recently

[sharp sky]

:))

[sullen sorrel]

i joined 2020

[sharp sky]

Oh

[sullen sorrel]

😱

[mellow zinc]

No need to shout.

[sullen sorrel]

ok time to make new gmail account

[mellow zinc]

why

what is wrong with dkim19375

@gmail.com

[sullen sorrel]

i lost access to that account

lol

[mellow zinc]

lol

[sharp sky]

Noob

[mellow zinc]

😐

[long summit]

His new email [e-mail]

[mellow zinc]

nice

[analog marlin]

dkim19376

[sharp sky]

Hack time

[analog marlin]

another one bites the dust

[sullen sorrel]

uh

okay time to think of a new email

[light scaffold]

Bridget Monad is typing...

[mellow zinc]

damn thats crazy

[sharp sky]

If i can guess the alt, you pay me nitro. Deal? 👀

[sullen sorrel]

noo

im too scared

why is iit so hard to think of usernames

[mellow zinc]

u dont make any sense

[sullen sorrel]

i need an alt

a different profile

[wary willow]

U know gmail has a username generator right? Based on the name you give it

[sullen sorrel]

a place where i can be freee

[sullen sorrel]

yea but i dont want it to be related to dkim19375

[wary willow]

NotDkim19375

[sullen sorrel]

hm

[analog marlin]

dank19375

[sharp sky]

HotDkim19375 :)))

[sullen sorrel]

🥵

[wary willow]

Well if he puts a lie in his name everyone will know he's a liar

[sullen sorrel]

oof

[sharp sky]

Neat 👀

[normal sable]

hey 😄

how's it been

😦

no I didn't

[sullen sorrel]

😦

[sharp sky]

Bm i see what you're tryna do 👀

[wary willow]

https://i.imgur.com/4j7Zt6R.png neat

[sullen sorrel]

ok i thought of a username

😄

[wary willow]

how tf do I make my discord full screen. Well more exactly how do I exist from full screen mode. I accidentaly pressed something and its not F11

[normal sable]

oh I see

[sullen sorrel]

hm

[sharp sky]

Ctrl + Shift + F i think @wary willow

[wary willow]

oh ty

[sharp sky]

Can't remember

Nice

[sullen sorrel]

discord has anti-alt?

[magic summit]

Why are people using guilded?

[wary willow]

ohhh there's a KeyBind thing in Settings. I didn't know

[sharp sky]

I remembered that keybind lol

[long summit]

Dkim, what is the story behind your username?

[sullen sorrel]

hm

i made it a long time ago

[analog marlin]

he increases it by one for every person he's killed

[sharp sky]

Yeah i was gonna asking that 👀

Then got distracted lol

[long summit]

My username is from 2011, I am sure you can remember yours lol

[sullen sorrel]

i dont remember how got the numbers

[light scaffold]

I wonder why your username is Matt

[sharp sky]

There are a lot of Matts' in this universe lol

[teal solstice]

wots going on..?

[long summit]

No, the other one

No lol

Check my spigot page

[teal solstice]

Can someone get me upto speed..?

[sullen sorrel]

forgot to verify email, whoops

[long summit]

=whois

[honest thistle]

Matt#7079

Profile

@long summit

ID:

180369172046413824

Created:

May 12 2016

Status

Online

Linked Accounts:

**GitHub: **ipsk
**Spigot: **ipsyko
**Minecraft: **LichtHund

[sharp sky]

Let's just say... dkim bully time 🤡

[teal solstice]

bully whome..?

[sullen sorrel]

me

[honest thistle]

efefury#1234

Profile

@low vale

ID:

229641594049921025

Created:

Sep 25 2016

Status

Do Not Disturb

Linked Accounts:

**GitHub: **efefury
**Spigot: **efefury

[sullen sorrel]

that's why im making an alt

so that i can escape

[teal solstice]

icic

[sullen sorrel]

BUT

i can't join the server yet

[teal solstice]

=whois 521485088995672084

[honest thistle]

dkim19375#6351

Profile

@sullen sorrel

ID:

521485088995672084

Created:

Dec 9 2018

Status

Offline

Linked Accounts:

**GitHub: **dkim19375
**Spigot: **dkim19375

[sullen sorrel]

or else it'll be to obvious

[sharp sky]

Let's see if you can escape 👀

[sullen sorrel]

lol

so ill probably join in like a week or two

maybe longer

when you guys forget

[magic summit]

How can you link your MC account? 🤔

[sullen sorrel]

back when mc server was up

[magic summit]

mkay

[mellow zinc]

was it?

[mellow zinc]

i thought u could link mc way before that

[sullen sorrel]

embed/image isn't loading for me😦

oh

it loaded

lol

[mellow zinc]

do i see... better discord????????

[long summit]

God using better discord sounds horrible lol, imagine seeing a message per edit

[sullen sorrel]

oh

lol

[long summit]

BM is writing a book

[mellow zinc]

Bridget Monad is typing...

[sharp sky]

He's been "fake" typing for 10 mins now 👀

[light scaffold]

hey

[analog marlin]

hey

[light scaffold]

not true

(maybe true)

[mellow zinc]

(is true)

[sharp sky]

Or you probably are manually typing all the bits in to create a "hey" word xD

[normal sable]

:petthebristermitten:

[sharp sky]

01011001 01101111 01110101 00100000 01101110 01101111 01101111 01100010

[long summit]

01000010 01110010 01101001 01100100 01100111 01100101 01110100 00100000 01001101 01101111 01101110 01100001 01100100 00100000 01101001 01110011 00100000 01110100 01111001 01110000 01101001 01101110 01100111 00101110 00101110 00101110

[teal solstice]

01111001 01100101 01110011 00100000 01101000 01100101 00100000 01101001 01110011

[normal sable]

u typing up an essay bm?

[sharp sky]

Holy jesus

Almost call that number

When i press that array number

[light scaffold]

nah

[sullen sorrel]

ahhh i turned it back on dark mode

and it looks ugly

[sharp sky]

Look

[teal solstice]

01000101 01111001 00100000 01110011 01101111 00100000 01110111 01101000 01100001 01110100 00100000 01101000 01100001 01110000 01110000 01100101 01101110 01100100 00100000 01110100 01101111 00100000 01110100 01101000 01100001 01110100 00100000 01110110 01101001 01110011 01101001 01101111 01101110 00100000 01100111 01110101 01111001

[sharp sky]

Are we talking binary now? Ok

[teal solstice]

01110011 01110101 01110010 01100101

[light scaffold]

@sullen sorrel Haskell time? 👉 👈

[sullen sorrel]

i have 10 minutes

so sure

[sharp sky]

01001101 01101111 01110110 01100101 00100000 01101111 01101110 01110100 01101111 00100000 01100001 01101110 01101111 01110100 01101000 01100101 01110010 00100000 01110100 01101111 01110000 01101001 01100011 00100000 01110100 01101000 01100001 01101110 00100000 01100010 01101001 01110100 01110011 00100000 01110000 01101100 01110011

There. I'm done

[light scaffold]

cool

so

what now

[sullen sorrel]

uh

gimme challenge 🙂

and then i can learn

[teal solstice]

01101011

[light scaffold]

ok

[sullen sorrel]

how to do it

[light scaffold]

how difficult

[mellow zinc]

make minecraft

[light scaffold]

yep

[analog marlin]

MDEwMDAxMTEgMDEwMDAwMTEgMDEwMDAxMDAgMDEwMDAwMTE=

[sullen sorrel]

72% = i know
28% i don't know

[light scaffold]

hmm

[analog marlin]

decode it

you know you want to

[sharp sky]

Looks sus

[light scaffold]

make a caesar cipher dkim

[sullen sorrel]

O_O

hmm

[light scaffold]

allow user to input text and shift (can be negative to reverse) and print the output

[sullen sorrel]

alright

[light scaffold]

only needs to work with alphanumeric

try and use readMaybe for the number parsing, makes it a bit prettier

or don't

[analog marlin]

ZGtpbSBpcyBzdXM=

[teal solstice]

https://media.discordapp.net/attachments/834380177433034774/836279184187588608/unknown.png

:/

[sullen sorrel]

alphanumeric = a-Z,0-9?

[analog marlin]

it's base 64

[light scaffold]

yes

[mellow zinc]

dkim is sus

[sullen sorrel]

am i allowed to have a list containing all the characters

[mellow zinc]

GCDC GCDC

[light scaffold]

Sure

Although using chr and ord might be cleaner

[analog marlin]

yeah i actually butchered the first one a bit

just fixed it

[sullen sorrel]

yea i know

what is chr

[long summit]

('a'..'z')

[teal solstice]

GCDCGCDC

[mellow zinc]

GCDC

[light scaffold]

Int -> Char

[sullen sorrel]

oh

[analog marlin]

aHR0cHM6Ly93d3cueW91dHViZS5jb20vd2F0Y2g/dj1NNVZfSVhNZXdsNA==

[light scaffold]

chr . ord = ord . chr = id

Wow

[stark rapids]

https://cdn.discordapp.com/attachments/681581023301206031/836279915900305448/parrot.mp4_20210426_123624_0.mp4

Ah hacks

[mellow zinc]

stick bugged 👀

[sullen sorrel]

but the thing with ascii

is that 0-9 is like 50, then a-z is like 90

[mellow zinc]

this wouldntve happened if u were using cheatbreaker

[sullen sorrel]

oh wiat

nvm it doesn't matter

ok ima move to dev den

[light scaffold]

allons-y

[mellow zinc]

cya

[stark rapids]

:0

[analog marlin]

45IBd+AoRTdM3z1v1KSiYQ==
thisISaSECRETkey

[wary willow]

o

[woven prairie]

https://nvlabs.github.io/face-vid2vid/ hmmm

[stark rapids]

https://cdn.discordapp.com/attachments/319137325147750401/836317393219223624/Meme.mp4

Meme 😄

[normal sable]

remember when that one guy said he bought minehq and was willing to pay 57k for some devs? haha only ogs remember

[fair island]

when ya make a joke tiktok then it gets almost 1,000 views lol

[wary willow]

😮

Odin for influencer soon™️ ?

[fair island]

759 😦

[wary willow]

still

[fallow crow]

:o

[wary willow]

better than what I'd do in a year

[lofty harbor]

#827055634586271775

[fair island]

https://www.tiktok.com/@untouchedodin0/video/6955255455283203334

it couldn't animate the mouth but it still looks funny

[junior cloud]

Why is there the voice AFK channel?

[fair island]

why not

[mellow zinc]

for afk people

they will be moved from the other channels automatically if they are afk long enough

[junior cloud]

Ok

[fair island]

didn't know that

[lofty harbor]

Why are there afk people?

Besides dkim

[fair island]

and bm

[light scaffold]

WHAT

I am the antithesis of afk

[sullen sorrel]

👀

imagine getting boosted every 2 minutes 👀
(note: this is not my server)

[naive agate]

Imagin

[magic summit]

I wish...

[lofty harbor]

In the game Crash in #showcase , couldn't you just always stop it right away and make infinite money?

[trim raft]

https://img.brett.lol/2021/04/eZaypkC0zR.png

[sullen sorrel]

no, basically, the longer you wait, the more money you get

but if it crashes, you get no money (so you lose money)

so if you bet $100, and wait until 2x, you'll get $200

[lofty harbor]

Yeah, so why not keep stopping it and make more money?

[sullen sorrel]

because if you stop it at x1.01

you'll only make $1

[lofty harbor]

So?

[sullen sorrel]

¯_(ツ)_/¯

go big

🙂

[lofty harbor]

It's free money

[sullen sorrel]

people dont want to make $1

they want to make $100s

[lofty harbor]

Bet 1,000 and make 10

Easy

[sullen sorrel]

risking 1k just to get $10

[lofty harbor]

Or be risky, bet $100 and wait till 1.5x, then make $150 each time

[sullen sorrel]

1.5 is very little

[lofty harbor]

You will probably win more than you lose

[sullen sorrel]

hmm

[lofty harbor]

$50?

I'd take $50 every 5 seconds

[sullen sorrel]

also

didn't someone make a #827055634586271775 for it

lol

[lofty harbor]

Yeah, that's probably what it is

[tawdry tree]

Theres a chance it fails at the beginning, no?

[sullen sorrel]

yes

[lofty harbor]

What's the chance?

[sullen sorrel]

idk

ah here it is

#827055634586271775 message

yea i just watched the yt vid

bc i was curious

was coding bedwars so i couldn't make it 😦

[tawdry tree]

No idea but its probably possible, never played crash that much personally

[sacred wasp]

whats the format for share your server?

[fallow crow]

see the pinned message in there

[normal sable]

https://vm.tiktok.com/ZMeC27aCa/

It was a lucky guess 🌚

[magic summit]

The recent comment on github man...

[tawdry mantle]

Hey @olive gull! When you gonna stop bombarding my Discord server with your advertisers? 🙂

[tawdry mantle]

Be careful of this everyone, Energy is a slippery one. I attach a screenshot with the specific details blurred out as to not give him more clicks than he deserves:
https://i.imgur.com/N4VXT93.png

[sharp sky]

Quite a few people have reported him of that situation already

Wonder if staffs even care

[long summit]

Well, posting here is not reporting, if they want to report then message Barry, I think i've told them before but they keep posting here instead

[fallow crow]

smdh

[sharp sky]

The last dude yesterday did

[wary willow]

Funnycube probably checks reports once in a while not every day

also only admins have access to it and most of them have been busy lately

[sharp sky]

Idk, most of my reports are executed within a day

[wary willow]

I mean clip has just came back after 19 days of silence and probably gonna be like that for another 19 days from now on, piggy idk if he even watches those and glare is apparently studying

[fallow crow]

Clip is like a bear

[wary willow]

and cube sent only 2 messages today

1 of them was a daily ping

xD

[fallow crow]

Coming in and out of hibernation periodically

[sharp sky]

Or maybe he is spying right now 👀

[wary willow]

maybe

[tawdry mantle]

I've already reported - just. getting stormed. I've revoked all invites and blocked new members completely

[wary willow]

also even if he gets banned here he's probably not going to stop

report them to discord as well

[tawdry mantle]

We're gathering all the materials we need for discord reports atm, European server tho, all the ppl are sleeping xD

He was smart enough to avoid msging staff lol

[queen jewel]

https://tenor.com/view/umm-confused-blinking-okay-white-guy-blinking-gif-7513882

[long summit]

Oh no, you're reviving that conversation xD

[latent schooner]

I'm thinking of getting a domain for myself, what should I buy? fredthedoggy.com?

.me?

[wary willow]

fredthedog.gy

[latent schooner]

Google Domains doesn't support the .GY ending

[wary willow]

what's a google domain?

[long summit]

I like .me domains

[latent schooner]

https://domains.google

[wary willow]

oh btw Matt it did relocate just need to test now

[latent schooner]

they just only support some endings

[wary willow]

300 apparently

xD

[long summit]

🥲

[latent schooner]

lol

[wary willow]

yeah blitz.com is like a 16k as well if I remember correctly

[latent schooner]

mat.page is only $540/y

[wary willow]

idk about blitz.me

[latent schooner]

so, do I buy fredthedoggy.com? :p

[lofty harbor]

What do you want it for?

[latent schooner]

Development, and just a page for myself

[wary willow]

u expect to keep the nickname?

[lofty harbor]

Expensive

[young mortar]

what about thankyoubli.tz

[latent schooner]

what host is that?

[latent schooner]

probably

have had it for a bit now

[long summit]

Namecheap

[latent schooner]

wiw

[young mortar]

free .me domain with github student developer pack

might be worth checking out

[long summit]

^

[latent schooner]

which site?

[wary willow]

get it from namecheap and then move to cloudflare or get it from clodflare

[latent schooner]

isn't it one year only?

[wary willow]

cloudflare*

they have better prices than anywhere

[young mortar]

i mean yeah but a year is a year man

save you like $10

[wary willow]

also best protection

[young mortar]

https://education.github.com/pack

[latent schooner]

fair

[wary willow]

so no need to move to their nameservers

[latent schooner]

I have it

for IJ ultimate

[young mortar]

oh its from namecheap

[latent schooner]

just on a seperate github acct

[young mortar]

if you go to the list

[latent schooner]

lmao it went up because multiple people searched it

[long summit]

You don't need to move it to cloudflare just set the namespace (i think that's the name)

[young mortar]

yeah you can just set the nameservers

[latent schooner]

right, imma do that

[young mortar]

but also i thought cloudflare has a domain registrar or whatever right

don't they sell domains too

[wary willow]

it does. you can also move to them after you bought from others

and its free...

[young mortar]

domains are free with them?

[wary willow]

other registrars take money if you want to move from them

[young mortar]

or migrating

[wary willow]

no

moving

[young mortar]

i see

[wary willow]

also like with my domain that I paid 12$ for I get it for like 8 or 9 on cloudflare

xd

I save 3$ per year

so good

[young mortar]

https://i.imgur.com/xhpXCRR.png

bro wtf fredthedoggy.me is expensive af

[latent schooner]

wtf it went up

all this exposure

[wary willow]

xD

[latent schooner]

and its worth more

[young mortar]

all 4 people searching it up lmao

[latent schooner]

haha

[wary willow]

I have not moved to cloudflare yet tho bcz it requires me to pay for another year lmao

[lofty harbor]

Wait let me look it up too

[latent schooner]

noooo

[wary willow]

yeah I'm on it as well

[latent schooner]

(kidding lol)

[young mortar]

i know that's why i did it lmao

[wary willow]

I just love it when it takes 5 hours to configure gradle https://i.imgur.com/XkM2TMu.png

[young mortar]

guilds is just kinda thicc

[wary willow]

5 minutes in now

[wary willow]

its more like hdd sucks

[young mortar]

oh yea yea

[wary willow]

lmao @latent schooner https://i.imgur.com/dBsrG5L.png

just going up

[young mortar]

at least it has a nice discount

[wary willow]

aham

xD

very nice

[lofty harbor]

I like ham

[wary willow]

yo https://i.imgur.com/H3PpnCu.png

[lofty harbor]

Bacon's good too

[wary willow]

this a good deal

https://i.imgur.com/7DElxjR.png

[young mortar]

yeah when fred opens his shop he's gonna be raking in the dough

[wary willow]

still waiting

nice https://i.imgur.com/R0iju98.png

[long summit]

Also Blitz, did the relocation work?

[wary willow]

it did relocate

idk if the plugins actually work now

bcz waiting for guilds

to build

lmao

[long summit]

Lmao

[wary willow]

7:33 minutes in

[young mortar]

stupid guilds

oh shit wait did i just commit a crime

[wary willow]

8 minutes in xD

[young mortar]

insulting the admin's plugin D:

[long summit]

What are you building?

[young mortar]

guilds

lmao

[long summit]

Oh

[wary willow]

https://i.imgur.com/9cnjpyL.png

[long summit]

Yeah i'm blind

[latent schooner]

oh come on, I need to give namecheap my address?

nvm

[wary willow]

something's not right there

[latent schooner]

I don't want to get a domain from them anymore :p

[wary willow]

fake name. fake addres etc. and also get whois protection. its free on namecheap

[long summit]

Yeah you need to give your address to domain companies then pay them to hide lmao

[young mortar]

never bought anything fred?

billing address go brr

[latent schooner]

not on namecheap

[wary willow]

lmao. I just give everyone my old address xD

[latent schooner]

I'm pretty young, and like my parrents would get confused AF

[young mortar]

toddler fred ordering a domain

[latent schooner]

obviously

don't ban me funny I'm above the discord TOS age ._.

[wary willow]

lmao

now waiting for the actual build..

another 2 minutes in

smh

[latent schooner]

is there an easy way to get a billing address thats not your home address? or would that be like a PO box

[wary willow]

oh. my. god. https://i.imgur.com/yAfgIxz.png

[latent schooner]

WHAT

[young mortar]

kotlin go brrrr

[latent schooner]

lol

[wary willow]

Its just parameter never used warnings lmaooo

[sharp sky]

Anyone gonna care about this damn spike? 👀

[young mortar]

damn bro what's the derivative of that graph near the end

fucking 50/1

[sharp sky]

It's literally their fault that our world is going to be doomed soon

[fading grove]

@queen jewel

wake up nerd

[long summit]

It's fucking scary

[young mortar]

vaccines go brrr

[long summit]

And still less deaths a day than Brazil somehow

[fading grove]

our school takes a covid test every single week

like we have to take one

every week

once

[young mortar]

yeah my uni does randomized tests

[long summit]

That's good

[fading grove]

do you do the thing where they get a swab

then you stick it up ur nose

and shit

[young mortar]

yeah you stick a swap up your own nose

[fading grove]

lmao yeah

[young mortar]

it's pretty quick tho

[fading grove]

and its pools right

pool testing

mhm

[young mortar]

in november i did my test, got food, got back to my dorm and saw my email "POSITIVE"

i was like bruh

[fading grove]

did you actually get it?

[young mortar]

i had no symptoms

[fading grove]

lol

[young mortar]

but i tested positive so i quarantined for 10 days so i dunno

[fading grove]

i guess you are just too good

[young mortar]

i know im just built different

too bad i invested all my points in virus resistance and not creativity cause i still can't think of a good lang name

[fading grove]

so first day in person learning for me and i took a covid test

imagine if it returns positive

and i have to return to virtual

[sharp sky]

It's damn hilarious on news broadcast on television, a man is literally crying over the infected dead next to him without wearing a face mask, along with crowded people around him

[fading grove]

💀

[sharp sky]

That broadcast is in India yesterday

[fading grove]

do yall schools have like this traffic route you have to take?

for stairs?

or smthing

in the school

[young mortar]

no cause those are dumb and do nothing

[fading grove]

we have to do that

lol

[young mortar]

they don't do anything though

[fading grove]

Yeah

they just crowd more

[sharp sky]

I had to take stairs to get to classroom lol

[young mortar]

they just make it so you have to loop all the way around if you miss shit

[fading grove]

Yeah

Good thing I have like 10-15 minutes between classes

[young mortar]

wtf bro in high school we had 5 min

[fading grove]

we also have a 1 hour lunch block

¯_(ツ)_/¯

lmao

[sharp sky]

At least you can take health exercise from it :p

[young mortar]

we had 40 min lunch

[fading grove]

i have to climb stairs back and forth on some days lmao

like 1 -> 3 -> 1 -> 2 -> 1 -> 4

lol

[wary willow]

@long summit finally got to test it and they all seem to work

thanks a lot

[young mortar]

https://i.imgur.com/r5smAq2.png

found my new lang name guys

[long summit]

Nice

[sharp sky]

Soon™

[long summit]

hopefully not 🤞🏼

[lofty harbor]

Yep

[fading grove]

F

even a fish himself

has to follow traffic routes

[lofty harbor]

It gives me an excuse to take as long as possible to get to some classes

[fallow crow]

Your schools are weird lol

[lofty harbor]

If everyone walks in the same direction we can’t get COVID

[latent schooner]

My school is closed rn due to some idiot who got exposed and still came in, then tested positive.
Some people :(

[fallow crow]

my uni never reopened lol

absolutely no institution in my province did

because the governor is so stupid fuck

fuck

i hate him

[latent schooner]

I'm at a private school (not uni), and so they basically so what they want

[fallow crow]

unfortunately it doesn't work like that here

even privates

[latent schooner]

Well, we still follow rules, but I'm normally 4 days a week in person

Since they can

What state?

[lofty harbor]

Canada

[fallow crow]

Where my uni 👉 https://www.google.com/maps/place/La+Plata,+Buenos+Aires+Province/@-34.9204529,-57.9881898,13z/data=!3m1!4b1!4m13!1m7!3m6!1s0x95edbcb7595281d9:0x4ad309fcdcf0a144!2sBuenos+Aires+Province!3b1!8m2!3d-37.2017285!4d-59.8410697!3m4!1s0x95a2e62b1f0085a1:0xbcfc44f0547312e3!8m2!3d-34.921971!4d-57.9528809

[lofty harbor]

Fefo is a Canadian name

[fallow crow]

I wish I lived in Canada..

It's the first country I think of moving to as soon as I get the opportunity of getting the fuck out of this shithole

If I don't get to kill myself before that happens of course

[latent schooner]

No fefo! Don't! then I can't get help with java!

[fallow crow]

java sucks

[latent schooner]

Oh

What lang do you use?

[fallow crow]

java 🥲

[latent schooner]

Lmao

[fallow crow]

C++ is my bae

<3

[sullen sorrel]

kotlin 😍 🥰

[lofty harbor]

What about Skript?

[latent schooner]

Never. Say. That. Word. Again.

[lofty harbor]

Kotlin